Details for Lyrate rockcress Locus 16054223

Position : sca3 ( 5`- 4249315 .. 4248188 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_341194 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054223

Protein [Map View]
MDEIPLWTRVDDKRFESALVQFPEGSPYFLENIAQFLQKPLKDVKYYYQALVDDVALIESGNFALPNYRDDDYVSLKEAT
KSKNQGTGKKKGIAWSPNEHKLFLDGLNKYGKGDWKSIARECVKTRSPMQVASHAQKYFLRKNKKGKRMSIHDMPLGDAD
NVTVPVSHLNSTGQQPQFGDQILPDHYYHCSQDNVTNIPGSNLVFMGQQPHFGGQIPPNQSHPYSRDNVTVPESNLKPMG
EQPHFGDHISPDQYDRDFLDNFGFFYDDGEDDGSLASFEKLYYKA*

DNA
ATGGATGAAATTCCGCTTTGGACGAGGGTCGATGACAAGCGTTTTGAGTCAGCTCTGGTTCAATTCCCAGAGGGTTCGCC
GTATTTTTTGGAGAATATCGCTCAGTTTCTGCAGAAACCGTTGAAGGATGTGAAGTACTACTACCAAGCGTTGGTCGACG
ATGTTGCGCTGATCGAATCGGGTAATTTTGCTTTGCCCAACTACAGGGACGATGATTACGTGTCACTGAAGGAAGCGACT
AAGTCCAAAAACCAGGGCACGGGGAAAAAGAAGGGAATAGCTTGGTCACCAAACGAACACAAATTGTTTTTGGATGGACT
AAACAAGTATGGGAAAGGAGATTGGAAGAGCATAGCGAGGGAATGTGTGAAGACAAGGAGCCCGATGCAAGTGGCTAGCC
ATGCTCAGAAGTATTTTTTAAGGAAAAACAAGAAGGGGAAACGCATGAGTATCCATGACATGCCTCTGGGAGATGCGGAT
AATGTAACCGTCCCTGTATCCCACTTGAATTCTACGGGCCAGCAGCCACAGTTTGGAGACCAAATTCTTCCGGATCATTA
TTACCACTGCTCCCAGGACAATGTAACCAATATCCCTGGATCCAACTTGGTGTTTATGGGCCAACAACCACATTTTGGTG
GCCAAATTCCTCCAAATCAAAGTCACCCCTACTCCCGGGACAATGTAACCGTCCCTGAATCTAACTTGAAGCCTATGGGC
GAGCAGCCACATTTTGGTGACCACATTTCTCCGGATCAATATGACCGCGACTTCCTGGACAACTTCGGGTTTTTCTATGA
TGATGGTGAAGATGATGGGAGTTTAGCAAGCTTTGAAAAACTATATTATAAGGCTTAA