Details for Lyrate rockcress Locus 16054222

Position : sca3 ( 5`- 2288262 .. 2287961 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054222

Protein [Map View]
MGTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGILYALYVLTK*

DNA
ATGGGTACAGCTACTTGCGTTGATATTATTATCGCCATCCTCTTGCCTCCACTCGGTGTCTTTCTCAGATTTGGTTGCGG
GGTTGAGTTTTGGATATGTTTGGTTTTGACGCTGCTTGGGTATATTCCTGGGATCTTATACGCCCTTTATGTCCTCACCA
AATGA