Details for Lyrate rockcress Locus 16054221

Position : sca3 ( 5`- 2968170 .. 2972370 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054221

Protein [Map View]
MSNRSLHLKKISWLSSRILSDNVHGRFRRPITTPATCLAPSLDGDMNIGSKTLVEHCFSRGFASVRRVSRASSSSSPSSP
HVDLLSYIKASLDKLEGPSHHWLNRDIGNKQLFKDKGTYVVLAGHLLNETSDLSGFFEKLKLLQQRSPGVCFMCIHFSDQ
AQIADDRTALAELIVKEYLTFPVLLSEKEFPKTTGEVRYIVFKDFKNPLIYEEKDLDIASVAKALDSLTQYTEKSKSVRI
FTNTWSKQAEAIKESHFPSFFQDLLLYFPGCITADEVGERLFLSDTNHHRIIMFEKNGKILDSIGCFPGFEDGEFESAKM
LRPTGTLYDEEEDCLYIVDSENHAIRRANINSRVLETVYPKVIKKSGGLWSWIMEKMGLGKDDDTTVDADAKSEEFDARS
LLFPWHILKRNDESLLVINKSFSKLWIINIATREIEEVVEGFSKIMEICGQSITEKLSVLKHMPSNWLQQQTEAIISCKE
QPSASLLSSFTKLGDDIVMTDIDCQRVLKLNIDSRACSSIQFSNIGILGLPYWLFIPLERVFNLANGVQEAHLSHTQELR
LLPGKISLRLNIEIPPCTELVEPIQESCIWRQTRGAISEVSSAGSAVEPSEKVGVSQQWYDELDSLAKEIANPEAVEEEE
EEDVNPSEVEREEDGRIHIDCTVKTSPGSSELIVYAALYLRLPRNEETESASQEELARRIAEILKPVRNNTTMKEDLFVK
LLSKSKRELRDIVFMKPMHVRIRLDSMDHPKADNSRDVILTDSSVEVDISL*

DNA
ATGTCTAACAGAAGCCTCCATTTGAAGAAAATTTCATGGCTTTCTTCTCGGATTCTCTCAGACAATGTGCACGGTCGATT
TCGCCGACCAATTACCACTCCAGCCACCTGTTTAGCTCCTTCACTCGATGGAGACATGAACATTGGGTCCAAGACATTGG
TCGAACACTGTTTCTCTCGCGGATTTGCATCAGTACGACGAGTATCTCGAGCTTCTTCTTCTTCTTCTCCTTCCTCTCCA
CATGTTGATTTACTCTCTTATATTAAAGCTTCACTTGATAAACTTGAAGGTCCTTCCCATCATTGGTTGAATCGAGACAT
TGGGAATAAACAGCTTTTCAAGGACAAAGGAACTTATGTAGTTCTTGCTGGACATTTGCTAAACGAGACAAGTGATCTGA
GTGGTTTCTTTGAGAAACTAAAGTTGCTTCAGCAGAGGTCTCCGGGTGTCTGTTTCATGTGCATTCACTTCAGTGATCAA
GCTCAAATTGCTGATGATCGAACTGCTTTAGCTGAGTTGATTGTGAAGGAATACCTCACTTTTCCTGTACTACTTTCTGA
AAAAGAATTTCCCAAGACTACTGGGGAAGTACGTTACATCGTGTTTAAAGATTTTAAGAATCCTTTAATCTACGAAGAGA
AGGATCTCGATATTGCTTCTGTAGCTAAAGCTCTTGACAGCCTCACTCAATATACTGAGAAATCCAAGTCTGTCAGAATT
TTCACGAACACTTGGTCAAAACAAGCTGAGGCTATCAAGGAATCACATTTCCCTTCTTTCTTTCAGGATTTGTTACTCTA
CTTTCCAGGTTGTATCACTGCAGACGAAGTTGGAGAACGTCTGTTTCTTTCTGATACCAACCATCATCGTATAATTATGT
TCGAAAAGAATGGGAAGATTTTAGACAGTATTGGTTGTTTCCCAGGTTTTGAGGATGGAGAATTTGAATCTGCAAAGATG
TTACGTCCTACAGGGACCCTTTATGACGAAGAGGAGGATTGCCTTTACATTGTAGATTCTGAGAATCACGCCATTAGAAG
AGCAAATATAAATAGCCGGGTCCTGGAAACAGTATATCCAAAGGTTATTAAGAAAAGTGGTGGCCTATGGTCTTGGATAA
TGGAGAAAATGGGTCTTGGAAAAGATGATGATACAACAGTTGATGCTGATGCCAAATCAGAAGAATTTGATGCTCGCTCT
CTGTTGTTTCCATGGCATATACTGAAGCGTAATGATGAGAGTCTTTTGGTCATTAACAAAAGCTTTTCGAAGTTATGGAT
AATAAATATAGCTACACGAGAGATCGAAGAAGTCGTGGAAGGGTTTTCAAAGATAATGGAGATCTGCGGGCAATCAATTA
CAGAGAAGCTATCAGTGTTGAAACATATGCCTTCTAACTGGTTGCAACAGCAAACTGAGGCTATCATCTCATGCAAGGAG
CAGCCAAGTGCTTCCCTTTTATCTTCTTTTACTAAACTTGGGGACGACATTGTCATGACAGATATAGATTGTCAGAGAGT
TTTGAAGCTAAATATAGATTCTAGAGCATGCTCTAGCATTCAGTTCTCAAACATTGGGATCCTTGGGTTGCCCTATTGGT
TGTTCATTCCACTGGAGAGAGTTTTCAATCTAGCTAATGGTGTTCAGGAAGCACATCTCAGTCATACTCAGGAACTCCGG
TTATTGCCAGGTAAAATTAGCTTACGGTTGAACATAGAGATTCCTCCATGCACGGAGCTTGTTGAACCGATACAAGAAAG
CTGCATATGGCGACAGACAAGAGGCGCAATCAGTGAAGTCTCGAGTGCTGGAAGTGCAGTTGAACCTTCCGAAAAGGTTG
GAGTTTCACAACAATGGTATGATGAATTAGACAGCCTCGCCAAAGAAATAGCCAACCCCGAAGCAGTTGAGGAAGAAGAG
GAGGAAGATGTTAACCCCTCTGAGGTTGAAAGAGAAGAAGATGGACGTATTCACATTGATTGTACTGTCAAAACCAGTCC
TGGCTCAAGTGAGCTTATTGTTTATGCAGCTTTATATTTAAGACTGCCGAGAAACGAAGAGACAGAAAGTGCGAGCCAGG
AAGAACTTGCGAGAAGAATAGCAGAGATTTTAAAGCCAGTACGGAACAATACGACTATGAAGGAAGATTTGTTTGTGAAA
CTATTGTCCAAGTCAAAGAGAGAATTGAGAGACATTGTCTTCATGAAGCCGATGCATGTGCGGATAAGGTTAGACTCGAT
GGATCATCCAAAAGCCGATAACTCAAGAGACGTAATCTTGACTGACTCCTCTGTTGAAGTTGATATCTCTCTTTGA