Details for Lyrate rockcress Locus 16054210

Position : sca3 ( 5`- 8357489 .. 8356296 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054210

Protein [Map View]
MQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDFTLIPNHTLRRLIQEWCVANRSNGVERIPTPKQPADPTSVR
ALLSQASAITGTHVSVRSRAAALRRLRGFARDSDKNRVLIAAHNATEVLIRILFSETTSSELVSESLALLVMLPITEPNQ
CVSISSDPGRVEFLTRLLFDSSIDTRVNAAALIEIVSTGTKSADLKGMFSISNSESVFEGVLDLLRNPISSRRALKIGIK
TLFALCLVKSTRHIAITAGAPEILIDRLAADFDRCDTERALATVELLCRSPEGCAAFGEHALTVPLLVKTILRVSDRSTE
YAAGALLALCTAEERWREEAAAAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVPF*

DNA
ATGCAAGACCCTGTCACCGTCTGCACCGGCCAAACCTACGACCGAGCCAGCATCGAGTCATGGGTCTCCATCGGCAACAA
CACTACATGTCCAGTCACACGAGCTCCTCTCTCCGACTTCACACTCATCCCCAACCACACTCTCCGTCGTCTCATCCAAG
AATGGTGCGTCGCTAACCGCTCCAATGGCGTCGAACGTATCCCTACTCCTAAACAACCGGCTGATCCAACCTCTGTTCGA
GCTCTTCTCAGTCAAGCCTCCGCTATAACGGGAACTCACGTCTCTGTTCGTTCACGCGCCGCCGCTCTCCGCCGTTTACG
TGGATTCGCTCGTGATTCTGATAAGAACCGCGTTTTGATCGCAGCTCATAACGCTACAGAGGTTTTGATTAGGATTCTGT
TCTCTGAAACGACGTCGTCGGAGTTAGTCTCTGAGTCGTTAGCTCTTCTTGTTATGTTACCGATAACGGAACCGAATCAG
TGCGTTTCGATATCTTCGGATCCGGGTCGGGTTGAGTTTTTGACCCGGTTGTTATTCGATTCTTCGATCGACACACGCGT
TAACGCCGCCGCGTTGATCGAGATTGTATCGACGGGAACCAAATCGGCGGATCTGAAAGGAATGTTTTCGATTTCGAATT
CTGAATCTGTATTCGAAGGAGTTCTCGATCTTCTGAGGAATCCGATTTCGTCACGACGAGCTCTCAAAATCGGAATCAAA
ACTCTGTTCGCGCTCTGTTTAGTGAAATCCACGCGACACATCGCGATCACCGCCGGTGCGCCGGAGATTCTAATCGACAG
ACTCGCGGCGGATTTCGACAGGTGCGACACGGAGCGAGCCTTAGCGACGGTGGAGCTTCTCTGCCGATCGCCGGAAGGAT
GCGCGGCGTTTGGTGAGCACGCTTTAACGGTGCCGTTGCTAGTGAAAACAATATTAAGAGTTTCGGATCGCTCGACGGAG
TACGCGGCGGGGGCGTTGTTAGCGCTTTGTACGGCGGAGGAAAGGTGGAGGGAGGAAGCGGCGGCGGCGGGAGTGGTGGT
ACAGTTGTTGTTGATGGTGCAGAGTGAGTGTACGGAGAGAGCGAAGAAGAAAGCGCAGAAGTTACTGAAGCTTCTGAGAG
ATTCATGGCCTGACTACAATTCCTTCGCTAACTCCGATGACTTTGGTTGCAGCAGCCAAGTGGTCCCTTTTTAA