Details for Lyrate rockcress Locus 16053987

Position : sca3 ( 5`- 1637614 .. 1636136 -3` )
Annotation : [B2G] indoleacetic acid-induced protein 16
External links : CoGe
PGDD synteny : 16053987

Protein [Map View]
MINFEATELRLGLPGGNHGGEMVGKYNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSF
RKNVMSGQKPTTGDATVGNDKTSGSSGATSSASVCAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGT
YGPQGMKDFMNESILIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS*

DNA
ATGATTAATTTCGAGGCGACGGAGCTGAGGTTAGGGCTGCCGGGTGGTAATCACGGAGGAGAAATGGTCGGAAAATATAA
TGGCAAAAGAGGATTTTCTGAGACCGTTGATCTCAAACTGAATCTTTCATCAACGGCTATGGATTCAGTTTCCAAAGTCG
ATTTAGAGAATATGAAGGAGAAGGTCGTAAAACCACCAGCCAAGGCACAAGTTGTGGGATGGCCACCGGTACGATCTTTC
CGCAAGAACGTCATGTCCGGCCAAAAACCGACCACCGGAGATGCCACCGTAGGAAACGATAAGACTTCTGGCAGCAGTGG
AGCCACCTCATCCGCATCCGTATGTGCCGCCGTCGCTTACGTGAAGGTTAGCATGGATGGCGCACCGTACCTACGGAAAA
TTGACTTGAAACTCTACAAAACTTACCAAGATCTATCCGATGCCTTAAGCAAAATGTTTAGCTCTTTTACCATAGGCACC
TATGGACCACAAGGAATGAAAGATTTCATGAATGAGAGTATATTGATCGATCTTCTAAACGGATCAGATTATGTTCCAAC
ATATGAAGATAAAGATGGCGACTGGATGCTTGTAGGAGACGTACCGTGGGAGATGTTTGTTGATTCATGCAAACGTATAC
GAATAATGAAGGGATCAGAAGCAATCGGACTTGCTCCAAGGGCATTAGAAAAGTGCAAGAACAGAAGTTGA