Details for Lyrate rockcress Locus 16053968

Position : sca3 ( 5`- 1856403 .. 1852228 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053968

Protein [Map View]
MHRVGSAGSNGGSVRTRKEKKLTYVLNDANDTKHCAGINCLDVLKSSVSNDQSYLFTGSRDGTLKRWAFDEDATFCSATF
ESHVDWVNDAALAGESTLVSCSSDTTVKTWDGLSDGVCTRTLRQHSDYVTCLAVAAKNSNLVASGGLGGEVFIWDIEAAL
SPVTKPNDANEDSSSSNGVNVPVTSLRTVGSSNNISVQSSPSHGYTPTIAKGHKESVYALAMNDTGTMLVSGGTEKVLRV
WDPRTGSKTMKLRGHTDNVRVLLLDSTGRFCLSGSSDSMIRLWDLGQQRCLHTYAVHTDSVWALACTPSFSHVYSGGRDQ
CLYLTDLATRESVLLCTKEHPIQQLALQDNSIWVATTDSSVEKWPAEVQSPQKVFQRGGSFLAGNLSFNRARVSLEGLNP
PPAYKEPSITVPGTHPIVQHEILNNKRQILTKDAAGSVKLWDITRGVVVEDYGKISFEEKKEELFEMVSIPSWFTVDTRL
GCLSVHLETPQCFSAEMYSADLKVSGRPEDDKINLARETLKGLLGHWLAKKKHKPKPQVLISGDTLSVKDTKKNLSASKA
EDSSAASDPVYPPFEFSSVSPPSIITEGSQGGPWRKKITEYTGTEDEKDFPLWCLDAVLNNRLPPRENTKLSFFLHPCEG
SSVQVVTLGKLSAPRILRVHKVTNYVVEKMVLDNPLDSLALDATSVSGGQPQPLFAGNGLLQSGLKPWQKLRPSIEILCN
NQAKNSFHGSQLTVLSPDMSLATVRAYIWKKPEDLILNYRVAIAR*

DNA
ATGCACCGGGTTGGAAGTGCCGGCAGTAATGGCGGTTCTGTTCGCACTCGCAAAGAGAAAAAGCTTACCTATGTATTAAA
TGATGCCAACGACACAAAGCATTGTGCTGGCATAAATTGCTTGGATGTGTTGAAGTCGTCTGTTTCTAATGATCAAAGCT
ACCTCTTCACTGGAAGTCGTGATGGTACACTCAAGAGATGGGCATTTGACGAGGATGCTACCTTTTGCTCAGCTACGTTT
GAGTCTCATGTTGACTGGGTGAACGACGCTGCTCTGGCTGGTGAAAGCACTCTTGTTTCTTGTTCTTCAGACACTACGGT
CAAGACGTGGGACGGTTTATCAGATGGAGTCTGTACGAGGACCCTCCGTCAGCATTCTGACTATGTTACTTGTTTGGCAG
TTGCTGCAAAAAATAGTAATCTTGTTGCATCTGGTGGCCTTGGTGGGGAGGTTTTTATATGGGATATCGAAGCTGCTTTG
TCACCAGTTACAAAACCTAATGATGCTAATGAAGATAGTTCTTCTTCAAATGGTGTAAATGTACCTGTTACAAGTTTAAG
AACTGTTGGTTCGAGCAACAATATCTCTGTGCAGTCATCTCCATCTCATGGGTACACACCAACAATTGCCAAAGGCCATA
AGGAGTCTGTGTATGCTTTGGCGATGAATGATACCGGAACGATGCTCGTCTCTGGTGGAACAGAGAAGGTTTTACGTGTC
TGGGACCCTAGAACCGGTTCAAAGACTATGAAGCTGAGGGGGCATACAGATAATGTCAGAGTGCTGCTTCTGGACTCAAC
TGGCAGGTTTTGCTTGTCTGGGTCCTCTGATTCTATGATAAGACTATGGGATCTAGGTCAGCAGCGTTGTCTTCATACCT
ATGCGGTGCATACAGATTCTGTTTGGGCGCTTGCATGCACTCCATCATTTAGTCATGTTTATAGCGGTGGAAGAGACCAA
TGTTTATACTTGACAGACTTGGCAACAAGGGAGAGTGTTTTGCTGTGCACTAAGGAACATCCAATTCAGCAATTAGCGTT
GCAAGATAATAGTATATGGGTTGCAACTACAGACTCCTCTGTAGAGAAATGGCCTGCCGAAGTACAGAGTCCTCAAAAGG
TCTTTCAACGAGGTGGCTCATTCTTGGCTGGGAATTTGTCTTTTAATAGGGCGAGGGTGTCTTTGGAAGGACTAAATCCA
CCCCCTGCCTACAAGGAGCCGTCAATAACTGTTCCAGGAACTCACCCGATTGTGCAACATGAGATTTTGAATAATAAAAG
GCAAATTTTAACCAAGGACGCAGCTGGCTCAGTGAAACTATGGGATATAACTAGGGGTGTTGTGGTAGAGGACTATGGAA
AGATTTCATTTGAGGAGAAGAAAGAAGAACTGTTTGAGATGGTAAGCATTCCATCATGGTTTACTGTGGATACACGACTT
GGATGCTTATCTGTACATTTGGAAACTCCACAATGCTTCTCTGCTGAGATGTATTCAGCAGACCTTAAAGTTTCTGGGCG
ACCTGAAGATGATAAGATTAATCTAGCTCGTGAAACACTGAAAGGCCTGCTGGGTCACTGGCTGGCAAAGAAGAAACACA
AACCCAAACCCCAAGTTCTTATCTCTGGAGATACTTTATCTGTAAAAGATACCAAAAAAAATCTAAGTGCATCAAAAGCT
GAAGACAGTAGTGCTGCAAGTGATCCGGTGTATCCTCCATTCGAGTTTTCTTCCGTCTCCCCTCCTTCCATCATAACCGA
GGGTTCTCAAGGTGGACCATGGAGGAAGAAGATAACCGAGTATACTGGAACTGAAGATGAGAAGGACTTCCCATTGTGGT
GCTTGGATGCTGTCTTGAACAATCGCCTTCCACCTAGAGAAAATACAAAATTAAGCTTCTTCCTGCATCCATGTGAAGGT
TCATCTGTGCAGGTGGTTACACTAGGGAAACTTAGTGCACCCCGGATCTTAAGAGTTCACAAGGTTACCAATTACGTTGT
GGAAAAGATGGTCCTTGACAATCCTTTGGATAGTCTAGCTCTTGATGCAACAAGTGTTTCAGGAGGACAACCTCAGCCAC
TGTTTGCAGGAAATGGATTGTTGCAGTCTGGATTAAAGCCTTGGCAGAAACTTAGACCTTCCATTGAGATCTTATGTAAT
AACCAGGCAAAGAATTCGTTTCACGGATCTCAATTAACTGTCTTATCTCCAGATATGAGTTTAGCAACTGTACGGGCATA
TATATGGAAGAAACCTGAGGATCTAATTCTCAACTACAGAGTGGCTATAGCTAGATAA