Details for Lyrate rockcress Locus 16053848

Position : sca3 ( 5`- 6263117 .. 6258240 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478922 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16053848

Protein [Map View]
MLRGAEFEMSGGDSFEGTYEDHQIFRQVFFGSDPGNTTKRCLVTGVINFKCDSSKNVNSSLSSNSVVTSGYACLQGSEAS
ASKDGSEVNTKAKRVKLSGNKHLDARDEKGSAFNGYSDIACRIIPLHLVESSNKGVSTSSYLLKQSIEKGREVYLGGIVS
GKFKSQNLDKCDWKEFKAIASPVSQESFATRMVCAGASTPHSEKACFTPDELIMSKTCLKIDPKEDPRPLLYKYVCKLLT
AARWKIEKRKRSAGRKHIETFYISPEGRKFREFGSAWKSLGAILLADHKLMDTGTKKWTGINDFWSDLSLTLLDIEENLK
NLNLANTRALWWSALEPFVVAVFISKQVGSLRKGNKVEVARNSVLDKLKKKDAISLNMISGCPESVLTVSEGSHLVYDVD
ANQEIHSDIEVQTKIFPRKVSSRLERQNIIGKEISGTHEQEASKGVVASKLIAEDMHESVMRKNLHRRSKKISDIKPAPL
DQHDSLDSNSLDSLECQDKEMGNSHLISKASRDERLRNEKMKNSCCNAKKGRKKARKHYTQDDDLMVSKTIRNQGRGSRS
SQKKKTQKPKARTKKRNNKGGCRLLPRSTSNVENQFCQGNWSILGPRTVLSWLIATKVISRDEVIQLRDPDDDTVVKTGL
VTKDGVVCTCCNRTVSLSEFKNHAGFNQNCPCLNLFMGSGKPFASCQLEAWSAEYKARRNGWRSEEASDDDPNDDSCGVC
GDGGELICCDNCPSTFHQACLSMQVLPEGSWYCSSCSCQICSELVSDNGERSQDFKCSQCAHKYHGICLQGISKRRKLFP
ETYFCGKNCEKVYTGLSSRVGVINPNADGLSWSILKCFQEDGKVHSARRLALKAECNSKLAVALSIMEESFLSMVDPRTG
IDMIPHVLYNWGSNFARLDFDGFYTMVLEKDDVMISVASIRVHGVTVAEMPLVATCSKYRRQGMCRILVAAIEEMLMSLK
VEKLVVAALPSLVETWTEGFGFKPMDDEERDALKRINLMVFPGTILLMKTLYESTKPNTVAGACLCEDRNNPSIKEADLE
PGLDKAEFPMSTQVESCDQMVPSGSDEEPVPGLPVPLGAEQTEPTSETENPTQDSNADDRPKTTTVSMGEEECLQEEISK
FSEEGKEVTRASSSSASLEEVSGVGVVVVNNVSDEMLLCVDEQLDSDSSQDSE*

DNA
ATGCTTCGCGGAGCTGAGTTTGAGATGTCAGGAGGTGACTCCTTTGAGGGGACTTATGAGGATCATCAGATATTTAGACA
AGTCTTCTTTGGAAGTGATCCTGGAAATACTACTAAACGATGTCTCGTTACTGGAGTCATTAACTTCAAATGTGATTCCA
GTAAGAATGTTAATTCCTCTCTGAGTTCCAACTCTGTGGTGACAAGTGGATATGCATGTCTACAAGGTTCTGAGGCATCT
GCTTCAAAAGATGGTTCAGAGGTTAACACAAAAGCTAAGAGAGTGAAGCTTTCAGGTAATAAGCATTTGGATGCAAGGGA
CGAAAAGGGATCGGCTTTCAATGGTTATTCGGATATAGCTTGTCGAATAATCCCTCTACATTTAGTTGAATCATCTAACA
AGGGTGTTTCAACTAGCTCATATTTGCTAAAGCAAAGCATAGAAAAGGGAAGAGAAGTTTATCTGGGTGGCATTGTCTCC
GGAAAGTTTAAGTCACAAAACTTGGACAAATGCGATTGGAAGGAGTTTAAAGCTATTGCTTCTCCTGTTTCTCAGGAGAG
CTTCGCAACCAGAATGGTCTGTGCAGGTGCTTCTACGCCTCATAGTGAGAAGGCTTGCTTCACTCCTGATGAGTTAATTA
TGTCTAAAACCTGTCTAAAGATTGATCCTAAAGAGGACCCCCGTCCTCTTCTCTACAAATATGTCTGTAAGTTGCTTACT
GCTGCCAGATGGAAAATCGAGAAGCGCAAAAGATCAGCAGGTAGGAAACACATAGAAACATTTTACATATCGCCAGAGGG
ACGGAAATTTCGTGAATTTGGGTCAGCTTGGAAATCATTGGGTGCTATCCTATTAGCTGATCATAAGTTAATGGATACTG
GTACTAAGAAATGGACCGGTATCAATGACTTCTGGTCCGATCTCTCTCTTACTCTGCTGGACATCGAGGAGAACTTGAAA
AATTTAAATCTTGCTAACACACGGGCACTTTGGTGGAGTGCCTTAGAGCCTTTTGTGGTTGCTGTCTTCATTTCTAAGCA
AGTTGGTTCTTTGAGAAAAGGAAATAAAGTTGAAGTTGCAAGGAATTCAGTTCTTGACAAGTTGAAGAAAAAAGATGCGA
TTAGTTTGAACATGATTTCAGGCTGTCCTGAAAGTGTGCTGACAGTATCTGAAGGCAGTCACCTTGTTTATGACGTGGAT
GCTAACCAAGAGATTCATTCAGATATTGAGGTGCAAACTAAAATTTTCCCTCGAAAAGTTTCTTCAAGACTAGAGAGGCA
GAACATAATTGGTAAGGAAATCTCTGGGACTCATGAGCAGGAGGCTAGCAAGGGCGTTGTAGCTTCAAAGTTGATAGCAG
AGGACATGCATGAAAGTGTTATGAGAAAGAACTTACACAGAAGATCAAAAAAAATATCTGATATCAAACCAGCTCCCTTG
GACCAACATGATTCACTAGATTCTAATTCTCTCGATAGCCTTGAATGCCAGGATAAAGAGATGGGCAACAGTCACCTCAT
CTCAAAGGCAAGTCGGGATGAAAGGTTGAGAAATGAGAAGATGAAGAATTCATGTTGCAATGCAAAGAAAGGAAGAAAGA
AAGCTAGGAAGCACTATACTCAAGATGATGACCTTATGGTGTCGAAAACAATCAGAAACCAAGGGAGGGGTAGCAGATCA
AGCCAGAAAAAGAAAACCCAGAAACCAAAGGCTAGAACAAAAAAGAGAAACAATAAAGGAGGGTGCAGGCTGCTTCCCCG
AAGCACAAGCAATGTGGAAAATCAATTTTGTCAAGGAAATTGGTCTATTTTGGGTCCAAGAACTGTCTTATCATGGTTGA
TAGCTACCAAAGTAATTTCTAGGGACGAAGTAATCCAGTTACGAGATCCAGATGATGATACTGTGGTAAAAACAGGCCTG
GTAACTAAAGATGGAGTGGTTTGTACATGTTGCAACAGGACTGTATCACTTTCTGAATTCAAGAACCATGCTGGATTTAA
CCAGAACTGTCCATGTCTGAATCTTTTCATGGGGTCAGGAAAGCCTTTCGCTTCATGTCAGCTGGAAGCTTGGTCTGCTG
AGTATAAGGCTCGAAGAAATGGATGGAGATCAGAGGAAGCTTCTGATGATGATCCAAATGATGATTCTTGTGGAGTTTGT
GGTGATGGGGGTGAGCTGATCTGCTGTGATAATTGTCCATCTACCTTCCATCAGGCTTGCTTATCAATGCAGGTGCTCCC
TGAAGGAAGTTGGTATTGCTCGAGCTGCTCATGTCAGATATGCAGCGAGTTGGTTAGTGATAATGGTGAACGCTCTCAGG
ATTTTAAATGTTCCCAGTGTGCGCATAAATATCATGGAATATGTTTGCAAGGGATAAGTAAACGCAGAAAACTTTTTCCA
GAGACCTACTTTTGTGGTAAAAATTGCGAGAAGGTGTACACTGGCCTCAGTTCTCGTGTTGGGGTCATTAACCCTAATGC
GGATGGTCTGTCTTGGTCAATTCTGAAATGTTTTCAAGAAGATGGAAAGGTTCATTCTGCCCGAAGGTTAGCGCTGAAGG
CTGAATGCAACTCGAAATTAGCTGTTGCCCTATCAATTATGGAGGAAAGCTTTCTGTCTATGGTAGATCCAAGAACTGGT
ATTGACATGATACCTCATGTGCTATACAACTGGGGGTCAAATTTTGCTCGCTTAGACTTTGATGGGTTTTACACAATGGT
TTTGGAAAAGGATGATGTGATGATCTCAGTAGCATCTATCAGGGTTCATGGAGTAACTGTTGCAGAAATGCCTCTTGTAG
CTACGTGCAGCAAATATCGCCGACAGGGAATGTGCAGAATCCTCGTGGCTGCCATCGAAGAGATGCTTATGTCTCTCAAA
GTGGAGAAGCTTGTGGTAGCTGCATTGCCAAGTTTAGTGGAGACTTGGACTGAAGGTTTTGGCTTCAAACCCATGGATGA
TGAAGAGCGTGATGCTCTCAAAAGAATAAACTTGATGGTGTTCCCTGGGACAATTCTGCTCATGAAAACACTATACGAGA
GCACAAAACCCAACACTGTGGCAGGTGCATGTCTTTGTGAAGATCGCAATAACCCATCAATCAAAGAAGCAGATCTAGAG
CCAGGCCTAGACAAAGCCGAGTTTCCCATGAGTACCCAAGTTGAGAGCTGTGATCAGATGGTTCCATCAGGTTCAGATGA
AGAACCAGTCCCAGGCTTACCCGTGCCACTTGGAGCCGAGCAAACAGAACCAACTTCAGAAACAGAGAACCCAACCCAAG
ACAGCAATGCCGATGATAGGCCAAAGACAACAACAGTCTCCATGGGAGAAGAAGAATGTTTGCAGGAAGAGATATCAAAG
TTTTCAGAAGAAGGAAAAGAAGTGACAAGAGCTTCTTCTTCCTCTGCTTCCTTAGAAGAAGTTAGTGGTGTAGGAGTAGT
GGTAGTAAATAATGTTAGCGATGAGATGTTGCTTTGTGTTGATGAACAACTTGACTCTGATAGCTCTCAAGATTCGGAAT
AA