Details for Lyrate rockcress Locus 16053817

Position : sca3 ( 5`- 10653268 .. 10654364 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053817

Protein [Map View]
MEWRSLPLELQEEILSRVPAKSLARLRSTSKRWNALLKSGSFAKIHSANAPTESLIMIIMLKDSRVYLEIVNLHGVHNNV
APSFELGSRLYLKEPHICNVFHCEGLLLLCTIKENRLEVWNPCSGETKLIKPRNSYYKESNFFALGYANKSSGKKYKVLS
VDRRDHVPGISNNEYEIYDFTNDSWRVLGVTTNRIIRQNHPVFDFSTERFQSLSLPQPFPYIVAALSVVREEQLCLLGYY
NKETYSEDLNLWVTSSIGSVMSWSKFLTVHTINPGREILFADGMSFLAVEQTKVLVCFSNQILRIVGENNNIQHVDDHDR
DSMSRSSCSVLLKYVPSLAQIQ*

DNA
ATGGAGTGGAGAAGCCTTCCGTTGGAATTGCAAGAAGAGATACTTTCTAGGGTTCCGGCAAAATCTCTGGCACGATTGCG
TTCAACGTCGAAACGATGGAATGCTCTACTGAAATCTGGGAGCTTTGCTAAGATACACTCTGCTAATGCACCAACAGAGT
CTCTGATTATGATTATCATGTTGAAGGATTCTAGGGTTTACTTAGAGATTGTCAATCTCCATGGAGTTCACAACAACGTT
GCCCCATCTTTTGAGTTAGGATCTCGATTATACCTTAAAGAGCCGCACATATGTAACGTCTTTCACTGTGAAGGCTTATT
ATTGCTATGCACTATTAAGGAGAATAGACTCGAGGTTTGGAATCCATGTTCAGGAGAAACCAAGTTAATTAAACCTAGAA
ACAGCTACTACAAGGAATCAAACTTTTTTGCTCTTGGTTACGCCAACAAATCTTCCGGCAAGAAATACAAAGTCTTGAGC
GTGGATCGTCGAGACCATGTTCCTGGTATCTCCAACAATGAGTACGAAATCTATGACTTTACCAATGATTCTTGGAGGGT
TCTTGGTGTGACTACCAATAGGATTATAAGACAAAATCATCCCGTTTTTGATTTTTCAACAGAGAGATTTCAAAGTCTGT
CTCTTCCTCAGCCGTTTCCTTATATAGTTGCGGCTTTATCAGTGGTTAGAGAAGAACAACTCTGTTTGTTAGGTTATTAT
AATAAGGAAACATATTCAGAAGACTTAAATTTATGGGTGACATCTAGTATCGGATCAGTCATGTCATGGAGCAAGTTCTT
AACAGTGCACACCATTAATCCGGGTCGGGAAATATTGTTTGCTGATGGTATGAGTTTCTTGGCCGTGGAGCAAACCAAAG
TTTTAGTGTGTTTCAGTAACCAAATCTTACGTATTGTGGGAGAAAATAATAACATACAACATGTGGATGATCATGATAGA
GATTCTATGTCAAGATCATCTTGCTCAGTTCTTCTGAAATACGTTCCAAGTTTAGCCCAAATCCAATAA