Details for Lyrate rockcress Locus 16053772

Position : sca3 ( 5`- 11882167 .. 11884854 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053772

Protein [Map View]
MKNASLKLPLLIFILVITSNLGAEARKLTGVDDILIEGAAASPQYVDTDDDDTLNKAPSCKRDIDCSFQCPKGGFCNLRL
GKC

DNA
ATGAAGAACGCTTCTCTCAAGCTCCCACTCTTGATTTTTATTTTGGTCATCACATCTAATCTTGGAGCAGAAGCAAGAAA
GCTGACCGGAGTTGATGATATATTAATCGAAGGTGCCGCCGCAAGTCCACAGTACGTAGACACCGATGACGATGACACAT
TGAACAAAGCCCCATCTTGCAAGAGGGACATCGACTGTAGTTTTCAGTGTCCCAAGGGAGGATTCTGCAACCTACGCCTT
GGCAAATGTGA