Details for Lyrate rockcress Locus 16053770

Position : sca3 ( 5`- 9065936 .. 9064668 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053770

Protein [Map View]
MVKTRAQSIKRMSVVDALCIRSQISVKSTRYCKTVSKHLAKLQLAESGKNSSLVVCPAMGKTMKLYSMDARRCKLSLLST
IDPSQRSPEEFMYMISSYNGIICCVNMIYDEDVENRFCDLQIWICNPCTRETLLLPQGTPSFEFEPSIGVAYGSDVSDYR
VFRIFCTGKIIPEERGPAEGYYFQEGRYFTKYSHVLAYECEVYSSSTGSWKNIGPVPCVPMSCGLRPFRRTGHIFVNGKV
YWLVSLDGPGKILSVDLEGRFEVINLPAYPDGLREEEKITEASHLVNLKGSLGLLVIHPDNMDLWVWKHDGQKYSWDIEL
SDDVPIKNDELIIAVTAFDNKIICVNDTHWRVYDMETKKWKRRRGPRTGFCNPAMFPFTESVLPCNGGVKQ*

DNA
ATGGTCAAAACTCGTGCTCAGAGTATCAAGCGGATGAGTGTTGTAGATGCACTTTGCATCCGGTCTCAGATCTCAGTCAA
ATCTACCCGGTATTGTAAGACAGTTAGTAAGCACCTTGCAAAGCTACAGTTAGCAGAATCTGGAAAGAATTCATCATTGG
TAGTCTGTCCTGCTATGGGGAAAACAATGAAGTTGTATTCGATGGATGCAAGGAGATGTAAACTTTCCCTCCTCAGTACT
ATTGATCCATCTCAAAGAAGCCCTGAGGAGTTCATGTACATGATATCATCCTATAATGGGATCATCTGCTGTGTGAATAT
GATTTATGATGAAGACGTAGAAAACAGGTTCTGTGATCTCCAGATATGGATATGCAACCCTTGTACAAGGGAGACTCTCC
TTCTTCCCCAAGGAACACCCTCGTTTGAGTTTGAGCCAAGCATTGGAGTGGCTTATGGCTCTGATGTCAGTGACTATAGG
GTTTTCCGTATATTCTGCACTGGAAAGATAATTCCTGAAGAAAGGGGACCTGCGGAGGGATATTATTTTCAAGAAGGTCG
GTATTTTACAAAATACAGTCACGTTTTAGCCTACGAATGCGAGGTTTATTCGTCCAGCACGGGTTCTTGGAAAAACATCG
GCCCCGTGCCTTGTGTTCCTATGAGTTGTGGTCTTAGGCCATTCAGAAGAACTGGTCATATATTTGTCAATGGGAAAGTG
TATTGGCTTGTTTCTTTAGATGGGCCTGGTAAGATCCTCTCAGTAGATTTGGAAGGGAGATTCGAGGTCATAAACTTGCC
TGCATATCCAGATGGACTAAGAGAGGAAGAGAAGATCACAGAGGCAAGTCATTTGGTAAACCTGAAAGGTTCTCTCGGGT
TGCTTGTTATACACCCAGATAACATGGATCTATGGGTTTGGAAACACGACGGCCAGAAATATAGTTGGGATATTGAATTG
AGCGATGATGTTCCAATAAAAAATGACGAATTGATTATAGCCGTAACTGCATTCGATAACAAGATCATATGTGTGAATGA
TACACATTGGCGTGTATATGATATGGAGACTAAAAAGTGGAAGAGAAGAAGGGGCCCTCGTACTGGATTTTGTAATCCTG
CTATGTTCCCATTCACCGAAAGCGTTCTTCCATGTAATGGCGGTGTGAAGCAGTAG