Details for Lyrate rockcress Locus 16053735

Position : sca3 ( 5`- 554933 .. 556264 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16053735

Protein [Map View]
MGCVSSCFRVEDIDDYMNPNSSVYRNCPCIRCLAHNFLNLYISVFRRGETRSLPSSVQATASITSSSSHDNFLSEAFRST
PRPLPYDADPRYFRSLVSRREKGSSHSHEEVEPLRSDSDADSESFGVGGCKWANNKSTISDKDSKEEYSSKSSLRILRSK
SKSIMADSENMYILSEDEDVCPTCLEEYTSENPKIVTKCSHHFHLSCIYEWMERSENCPVCGKVMEFNETP*

DNA
ATGGGATGTGTTTCTTCTTGCTTCCGGGTCGAAGACATTGATGACTACATGAATCCTAATAGCTCTGTCTATAGGAACTG
TCCCTGCATAAGATGCCTTGCTCATAATTTCCTTAACCTGTATATCTCGGTCTTCAGAAGAGGGGAAACCCGCTCTCTCC
CATCTTCGGTTCAAGCTACTGCATCGATAACTTCCTCTTCTTCACACGATAACTTTCTGTCTGAAGCATTCCGTTCTACA
CCAAGACCTCTGCCTTATGATGCTGATCCTAGATACTTCCGCTCACTCGTCTCAAGACGGGAGAAGGGATCAAGTCATTC
CCATGAGGAAGTTGAACCTTTAAGAAGCGATAGCGATGCAGATTCTGAATCTTTCGGCGTAGGAGGGTGCAAATGGGCTA
ATAATAAATCCACCATCTCTGATAAAGATTCCAAAGAAGAGTACTCTAGTAAATCCAGTCTCAGGATTTTGAGATCAAAG
TCCAAGTCAATAATGGCCGACTCTGAAAACATGTATATATTGTCTGAAGATGAAGATGTCTGTCCAACTTGTCTTGAAGA
ATATACATCAGAGAACCCAAAGATTGTGACAAAATGTTCTCACCATTTCCACCTTAGTTGCATTTATGAGTGGATGGAGA
GAAGTGAAAACTGTCCTGTCTGCGGAAAGGTGATGGAATTCAACGAAACACCGTGA