Details for Lyrate rockcress Locus 16053730

Position : sca3 ( 5`- 4978918 .. 4980209 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053730

Protein [Map View]
MTTEEKEILAAKLEERKIDLDKPEAGGKSKQSRSEKKSRKAMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPASD
TYVIFGEAKIEDLSSQIQSQAAEQFKAPDLSNVISKGESSSATVVQDDEEVDEEGVEPKDIELVMTQAGVSRPRAVKALK
ATDGDIVSAIMELTT*

DNA
ATGACTACCGAAGAGAAAGAGATCCTCGCCGCCAAATTGGAAGAACGAAAGATCGATCTCGATAAGCCCGAAGCAGGAGG
TAAGTCAAAACAAAGCAGAAGTGAGAAGAAGAGTCGCAAAGCCATGCTTAAGCTCGGGATGAAACCCATCACTGGTGTTA
GCCGAGTCACTGTCAAAAAGAGCAAGAATATCTTGTTTGTCATATCAAAACCTGATGTGTTCAAGAGCCCAGCATCAGAC
ACATATGTGATCTTTGGAGAGGCGAAGATCGAGGACTTGAGCTCTCAGATCCAGTCGCAGGCAGCAGAGCAATTCAAGGC
TCCAGATCTCAGCAATGTGATCTCAAAGGGTGAGTCGTCGAGCGCTACAGTGGTTCAGGATGATGAGGAGGTTGACGAGG
AAGGTGTTGAGCCAAAGGACATTGAATTGGTGATGACTCAAGCAGGAGTGTCTAGGCCTAGGGCAGTGAAGGCTCTCAAG
GCTACAGATGGAGATATTGTCTCTGCCATCATGGAGCTTACCACCTAA