Details for Lyrate rockcress Locus 16053713

Position : sca3 ( 5`- 6146167 .. 6147681 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053713

Protein [Map View]
MHPETEQAPLVTVSPSKKTKLCSENFEDKFSSLHESVLSRILSQLQTVEAVSTSVLSKSWRNMWTNITELHFDDPKQRDP
SDSRFTDFVERVLSDIGSPQINSFHLRSVNSYDETLLFSWLSKVLKRNLQRLVVTCNDLEIINFSPLFPSLVSLVELRLR
TKSILDISAPALLPNLKFFSLEDARIFNMSSVSKNLVLNFPVLETFEASYCCYFRTDTVILDSPMLRIFEMFKCTSEHVP
NSEVCKIRVLASKLEKITFSGDDSRKIRLSFPPSLPDAYLALSKSEWPKKFLHSFTCVNSLALELSKDFHVIAVPKFRQL
VYLHLIYDMTQHCKLIQFLESAPILEMLSIRDLTSPRSTPTTKSLKELRSEESPDCVRTMLKILQIRNFKPNRLQISVLR
YVLDNAEILGSVILSSPNPITEEAKARILSYPKASPHASVFFE*

DNA
ATGCATCCAGAGACAGAACAAGCCCCTTTAGTGACGGTTTCACCTTCCAAGAAGACTAAGCTATGCAGTGAGAACTTTGA
AGACAAATTCAGCAGCTTGCATGAGAGTGTTCTTAGCAGAATTTTGAGTCAACTTCAAACTGTTGAAGCTGTTAGTACTT
CTGTGTTATCAAAGTCATGGAGGAACATGTGGACAAACATCACAGAGTTACATTTTGATGATCCAAAGCAGAGGGATCCG
AGTGATTCTCGGTTTACTGACTTCGTTGAGCGTGTGCTTAGCGACATTGGAAGTCCGCAGATTAACAGTTTCCATCTACG
TTCTGTTAATTCGTACGATGAGACTCTTCTCTTCTCGTGGTTATCAAAGGTACTAAAGCGCAATCTTCAGAGACTTGTTG
TCACTTGCAACGATCTTGAAATCATCAATTTTTCTCCTCTTTTTCCTAGTCTTGTTTCGCTTGTGGAGTTAAGACTCCGT
ACAAAGAGCATTCTTGACATTTCAGCTCCTGCTCTTCTCCCGAACCTTAAGTTCTTTAGTCTCGAGGATGCTAGAATCTT
CAACATGTCTTCTGTCTCAAAGAACCTCGTTCTGAACTTTCCTGTCCTGGAAACTTTTGAAGCCTCTTATTGCTGCTACT
TTAGAACCGATACTGTGATCCTAGATTCTCCGATGCTCAGGATCTTTGAGATGTTTAAGTGTACCTCTGAACATGTACCG
AATTCTGAAGTGTGTAAGATCAGGGTGTTAGCTTCAAAGCTTGAGAAAATTACATTCTCCGGGGACGATTCCCGAAAGAT
TCGTCTGTCTTTTCCACCGTCTTTACCTGATGCTTATCTAGCCCTCAGCAAATCGGAGTGGCCCAAGAAGTTTCTACATA
GCTTCACATGCGTGAATAGTTTGGCTCTCGAGCTTAGCAAGGATTTTCATGTGATCGCAGTACCCAAATTCAGACAGTTG
GTTTACCTGCATTTGATATACGACATGACACAACATTGTAAATTAATTCAGTTCCTCGAATCCGCACCAATACTCGAGAT
GCTCAGCATCCGCGACCTGACATCTCCTCGTTCAACCCCTACTACAAAGTCCTTGAAGGAACTACGTTCAGAAGAATCAC
CGGATTGCGTTAGAACAATGCTCAAAATCCTACAAATCAGGAATTTTAAGCCAAACAGGTTGCAGATATCAGTGTTGAGG
TACGTGTTGGACAATGCTGAGATTCTTGGATCAGTCATCCTTTCCTCGCCCAATCCAATCACAGAAGAAGCTAAAGCAAG
AATCTTGTCTTATCCTAAAGCCTCACCTCATGCCTCTGTCTTCTTCGAGTGA