Details for Lyrate rockcress Locus 16053702

Position : sca3 ( 5`- 1596629 .. 1596168 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053702

Protein [Map View]
MDLKKATSLFYFLLCLHLQHHFAHAISRSSTSVDPNHDDLPVQPVELKPDGDLIAANLTELAVVKKGGGGGGRGGGGFGG
GGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGGIRPIPIYGGGSHRGGHHSSGGREIASGWLGLSILAGLVLVF*

DNA
ATGGATTTGAAGAAAGCAACTTCGCTTTTTTACTTTCTTCTCTGTCTCCACCTGCAACACCACTTTGCTCACGCGATCTC
GCGATCTTCTACCTCCGTTGATCCAAACCATGACGATCTTCCGGTTCAGCCTGTCGAATTGAAGCCGGACGGTGACTTAA
TCGCCGCCAATTTAACGGAATTAGCAGTCGTTAAGAAAGGAGGCGGAGGTGGAGGCAGAGGCGGAGGCGGCTTCGGCGGA
GGAGGACGCAGTTTCGGTGGAGGAGGGAGTTCTAGCAGAGGCGGAGGGGGGAGTTCTAGCAGAGGCGGAGGAGGGAGTTC
TAGCAGAGGCGGAGGGATACGTCCGATTCCGATTTATGGCGGTGGTTCGCACCGCGGTGGTCACCATTCAAGCGGCGGCC
GGGAAATTGCTAGCGGTTGGTTAGGTTTATCGATTTTAGCCGGTTTGGTTTTGGTTTTCTAG