Details for Lyrate rockcress Locus 16053588

Position : sca2 ( 5`- 16474757 .. 16476199 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053588

Protein [Map View]
MKRLLSKSLCTSAAGANLKPPPADPAAIAKLILSFHQTLDDQFILSTKTTPWTPNLVNSVLKRLWNHGPKALQFFHFLDN
HHREYVHDASSFDLAIDIAARLHIHPTVWSLIHRMRSLRIGPSPKTFAIVAERYASSGKPDKAVKLFLNMHEHGCFQDLA
SFNTILDVLCKSKRVEKAYELFRALRGRFSADTVTYNVIVNGWCLIKRTPKALEVLKEMVDRGINPNLTTYNTMLQGFFR
AGQIRQAWEFFLEMKKRNCEIDVVTYTTVVHGFGVAGEIKRTRNVFDEMIREGVLPSVATYNAFIQVLCKKDSVENAVVM
FEEMVRKGYEPNVTTYNVLIRGLFHAGKFSRGEELMQRMENEGCEPNFQTYNMMIRYYSECSEVEKALGLFEKMGTGDCL
PNLDTYNILISGMFVRKRSEDMVVAGNQAFAKEILRLQSKSGGRLLRKFRL*

DNA
ATGAAACGTCTTTTAAGCAAATCGCTATGTACATCGGCCGCCGGAGCCAATCTAAAACCACCGCCGGCAGATCCCGCCGC
CATAGCTAAGCTCATCCTCTCTTTTCACCAAACCCTAGACGATCAATTTATTCTCTCCACCAAAACAACCCCATGGACCC
CAAATCTCGTCAACTCTGTTCTCAAGCGCCTCTGGAATCACGGTCCAAAAGCCCTCCAATTCTTCCACTTCCTCGACAAT
CACCACCGCGAATATGTCCACGACGCTTCCTCCTTCGACCTCGCAATCGACATTGCCGCCCGTCTTCACATCCACCCCAC
CGTCTGGTCCCTCATTCACCGTATGCGCTCTCTCCGCATCGGTCCTTCTCCCAAGACCTTCGCAATCGTCGCCGAGAGGT
ACGCTTCCTCCGGGAAACCCGATAAAGCGGTAAAGCTGTTTCTGAATATGCACGAACATGGTTGTTTTCAGGATTTGGCT
TCTTTCAATACGATTCTCGATGTGTTGTGTAAATCTAAACGCGTTGAGAAAGCTTATGAGTTGTTTAGGGCTCTTAGGGG
GAGATTTAGTGCTGATACAGTTACTTACAATGTGATTGTTAATGGTTGGTGTTTGATCAAACGGACGCCTAAGGCTTTGG
AGGTTTTGAAAGAGATGGTTGATAGAGGGATAAACCCTAATTTGACTACTTATAACACAATGCTCCAAGGTTTTTTCAGA
GCTGGGCAGATTAGACAGGCTTGGGAATTCTTCTTGGAGATGAAGAAACGGAATTGTGAAATTGATGTTGTTACTTATAC
TACTGTGGTTCACGGGTTTGGTGTTGCGGGGGAGATAAAGCGGACGAGGAATGTTTTCGATGAGATGATTAGAGAAGGTG
TGCTTCCTTCTGTTGCGACATACAATGCTTTCATTCAAGTTTTGTGTAAGAAAGATAGCGTAGAAAATGCGGTTGTCATG
TTTGAGGAAATGGTGAGGAAAGGTTATGAGCCGAATGTGACGACTTATAATGTGTTGATCAGAGGGTTGTTTCACGCTGG
AAAGTTCAGTCGCGGAGAGGAGTTGATGCAGAGAATGGAAAATGAAGGCTGTGAACCAAACTTCCAGACATACAATATGA
TGATACGCTATTATTCGGAATGCAGCGAGGTTGAGAAAGCATTGGGTTTGTTTGAGAAGATGGGGACTGGTGATTGCTTG
CCAAATCTAGATACTTATAACATACTGATTAGTGGAATGTTTGTGAGAAAAAGATCAGAAGATATGGTGGTCGCTGGGAA
TCAAGCTTTCGCAAAGGAAATCTTGAGATTGCAGAGTAAATCTGGTGGCAGGCTTCTCCGCAAGTTCAGGCTATGA