Details for Lyrate rockcress Locus 16053579

Position : sca5 ( 5`- 18010021 .. 18011120 -3` )
Annotation : [B2G] thylakoid lumenal 20 kda protein
External links : CoGe
PGDD synteny : 16053579

Protein [Map View]
MATASLVLTSKVFSVSSKCSALIKARTGVVVASAQQQQQPRRRELLLKSAVAIPAILQLKEAPISEAREVEVGSYLPPSP
SDPSFVLFKAKPSDTPALRAGNVQPYQFVLPPNWKQLRIANILSGNYCQPKCAEPWIEVKFENEKQGKVQVVASPLIRLT
NKPNATIEDIGEPEKVIASLGPFVTGNSYDSDELLKTSIEKIGDQTYYKYVLETPFALTGSHNLAKATAKGNTVVLFVVS
ATEKQWQSSQKTLEAILDSFQL*

DNA
ATGGCGACTGCATCTCTAGTTCTGACATCTAAAGTCTTCTCTGTCTCTTCGAAATGCTCAGCTTTGATTAAAGCAAGGAC
TGGCGTAGTTGTTGCATCGGCGCAACAGCAACAACAGCCAAGAAGGAGAGAGCTGCTGCTGAAATCGGCAGTGGCGATTC
CGGCGATTCTGCAATTGAAGGAAGCTCCGATATCGGAGGCGCGTGAAGTGGAAGTTGGATCATACTTACCTCCGTCGCCG
TCTGATCCTTCCTTCGTCCTCTTCAAAGCCAAACCTTCAGATACTCCTGCTCTCCGCGCAGGAAATGTTCAGCCCTATCA
GTTTGTTCTACCTCCGAACTGGAAACAGTTGCGAATAGCCAACATTTTATCAGGTAACTACTGCCAACCGAAATGCGCAG
AGCCATGGATCGAAGTGAAGTTTGAGAACGAGAAGCAAGGCAAAGTTCAAGTAGTTGCATCTCCTTTGATCCGCTTAACC
AACAAACCAAATGCAACCATTGAGGATATCGGTGAGCCTGAGAAAGTGATTGCTTCTCTTGGTCCTTTTGTCACCGGAAA
CTCTTATGACTCTGATGAACTTTTGAAGACTTCAATCGAAAAGATTGGAGATCAAACGTACTATAAGTATGTGTTGGAGA
CACCATTTGCGCTCACGGGAAGTCACAATCTTGCAAAAGCGACAGCAAAGGGAAACACGGTGGTTCTGTTTGTCGTGAGT
GCTACTGAAAAGCAATGGCAGAGCTCACAGAAGACTCTTGAAGCCATTCTTGATTCTTTTCAACTGTAA