Details for Lyrate rockcress Locus 16053496

Position : sca3 ( 5`- 3241518 .. 3240641 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053496

Protein [Map View]
MVNKKRLSSKDDFSDTYTCDLEFRITNSNGFLPPDSPEKLDSSHAAFDAAEQTPSMLMKSRKKRKVRAFVEQEVVTNVEP
ENDDGSAKGDSFDKLPSENVDKTIEIGTGGKESEVVEAVTNGEPENHDGSAKKGDSCDDKLPSDNVDKHMENEANGKESE
EDGAADELCALQDALERTLFQHLGKYAQKQMLEKLRSLRAKDRKELSGEWKSLLAQEALLKSKKHSFSAKLANATFHN*

DNA
ATGGTAAACAAGAAACGGCTTTCTTCTAAAGATGATTTCAGCGACACCTATACATGTGACTTAGAATTCCGAATCACCAA
CTCCAACGGCTTCCTTCCTCCTGACTCGCCGGAGAAATTGGACTCCAGCCACGCTGCTTTCGATGCCGCCGAACAAACAC
CAAGCATGTTAATGAAGAGTAGAAAGAAACGCAAGGTTCGGGCTTTCGTGGAACAGGAGGTGGTGACAAACGTTGAACCC
GAGAACGATGATGGATCAGCAAAAGGCGACTCCTTTGACAAATTGCCTTCTGAAAATGTTGACAAAACTATAGAGATTGG
GACTGGTGGGAAGGAGAGTGAGGTAGTTGAAGCAGTGACAAACGGTGAACCTGAGAATCATGATGGATCAGCAAAAAAAG
GCGACTCTTGTGACGACAAATTACCCTCTGACAATGTTGACAAACATATGGAGAATGAGGCTAACGGGAAGGAGAGTGAG
GAAGATGGTGCTGCTGATGAGCTGTGCGCTTTACAGGACGCGCTTGAGAGGACACTGTTTCAACATTTAGGTAAGTATGC
ACAGAAGCAGATGCTTGAGAAGTTGAGGAGCCTTAGAGCTAAGGACCGGAAAGAGTTGAGCGGTGAATGGAAGTCATTAC
TTGCTCAGGAGGCGCTACTGAAGAGCAAGAAACATTCGTTTTCCGCCAAACTCGCAAATGCAACATTTCATAATTAG