Details for Lyrate rockcress Locus 16053471

Position : sca3 ( 5`- 5986848 .. 5983883 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053471

Protein [Map View]
MMIGKLCRSVGTVGKCDGRHYGVRTMVGKASNRAGVHGSKLPNAKPKEEDSLNFRLLSLLNVVTTQAYLTPLRSQTINHA
KFLQIPWRQFVFKKPLGLCKSTKLDEAVTLIEKSSTSPSNLSTPEAYTDLLHACISAKSLHHGIKICSLVLNNPSLRHDP
KLLSKLITLFSVCRRLDLARKIFDDVTDSSLLTEKVWAAMAIGYSRNGSPRDALIVYVDMLCSFIEPGNFSISVALKACV
DLKDLRVGRGIHGQIVKRKEKVDQVVYNVLLKLYMERGSFDDARKVFDGMSERNIVTWNSLISILSKKVRVHEMFNLFRK
MQEEMIGFSWATLTTILPACSRVAALITGKEIHAQILKSKEKPDVPLLNSLMDMYGKCGDVEYSRRVFDGMLTKDLTTWN
TILNCYAINGNIEEVINLFEWMIESGVAPDGITFVALLSGCSDTGLTEYGISLFERMKTEFRVSPALEHYACLVDILGRA
GKIEEAVKVIETMPFKPSASIWGSLLNSCRLHGNVSVGEIGTMLWLRTYIAEAKMWDNVDKIREMMKQRGIKKEAGCSWV
QVKDKIQIFVAGGGYEFRNSDEYKKVWTELQEAIEKSGYSPDTSVVLHDVDEETKANWVCGHSERLAATYSLIHTGEGVP
VRVTKNLRVCADCHSWMKIVSQVTGRVIVLRDTKRFHHFVAGICSCKDYW*

DNA
ATGATGATCGGAAAATTGTGTAGATCTGTGGGAACCGTCGGAAAGTGTGATGGTCGGCATTATGGCGTGAGGACGATGGT
TGGAAAAGCCTCGAACCGAGCTGGTGTTCATGGTTCGAAACTTCCCAACGCTAAACCCAAAGAAGAGGATAGTTTGAATT
TTCGCCTTCTCTCGCTCCTGAATGTTGTCACTACACAAGCTTATCTTACTCCATTGAGGTCTCAAACTATCAACCATGCT
AAATTCTTACAAATCCCATGGAGACAATTTGTCTTCAAAAAGCCTTTAGGTCTCTGTAAATCCACCAAACTCGACGAAGC
CGTGACCTTGATAGAGAAGTCATCAACCTCACCGTCCAATCTCTCTACTCCCGAAGCTTACACAGACCTACTTCATGCTT
GCATCTCCGCTAAATCGCTTCACCATGGTATAAAAATCTGTTCTTTGGTTCTCAACAATCCTAGTCTCCGTCACGATCCC
AAATTGCTTAGCAAGCTCATTACCCTTTTCTCGGTTTGTCGCCGATTGGATCTCGCTCGGAAAATCTTCGACGATGTCAC
TGATTCGAGTCTACTTACTGAGAAAGTCTGGGCAGCGATGGCGATTGGGTATTCTAGAAACGGGTCACCAAGAGATGCTT
TGATCGTGTATGTAGATATGTTGTGTAGTTTCATTGAGCCTGGGAATTTTTCGATATCTGTAGCGTTGAAAGCGTGCGTG
GATTTGAAAGATCTTCGGGTTGGTAGAGGAATCCATGGCCAGATTGTGAAACGTAAGGAGAAGGTTGATCAAGTGGTGTA
TAATGTGCTCTTGAAGCTTTACATGGAACGTGGCTCATTTGATGATGCACGTAAGGTGTTCGATGGAATGTCTGAGAGAA
ATATTGTTACTTGGAATTCTTTAATTTCGATACTCAGCAAGAAAGTTCGGGTTCATGAGATGTTTAATTTGTTCAGAAAG
ATGCAGGAAGAGATGATTGGGTTTAGTTGGGCGACTTTGACGACAATATTACCCGCTTGTTCACGTGTCGCTGCTCTTAT
CACTGGGAAAGAGATTCATGCGCAGATTCTGAAATCGAAAGAGAAACCTGATGTTCCGTTGCTTAATTCATTGATGGATA
TGTATGGGAAATGTGGAGATGTTGAGTATTCTCGGAGAGTCTTTGATGGGATGTTAACTAAGGATTTGACTACATGGAAC
ACGATTCTAAACTGTTACGCAATCAACGGAAATATCGAAGAAGTGATAAATCTGTTTGAATGGATGATAGAGTCAGGCGT
CGCACCAGATGGGATTACCTTTGTTGCTTTGTTATCCGGGTGTAGCGATACAGGGCTAACGGAATACGGTATAAGTTTGT
TTGAACGCATGAAAACTGAATTCAGAGTTTCACCGGCCTTGGAACATTATGCTTGTTTGGTTGACATCTTGGGCCGAGCT
GGTAAGATCGAAGAAGCAGTCAAGGTAATAGAAACAATGCCATTTAAGCCAAGTGCATCCATTTGGGGATCACTGCTCAA
CTCTTGCAGGCTCCATGGGAATGTTTCAGTGGGGGAGATTGGAACTATGTTATGGCTTCGAACATATATAGCTGAAGCAA
AGATGTGGGACAATGTCGATAAGATTCGAGAGATGATGAAACAAAGAGGGATCAAAAAGGAAGCTGGTTGCAGTTGGGTA
CAGGTTAAAGACAAGATTCAAATCTTTGTCGCAGGAGGTGGTTACGAGTTTCGTAATTCGGATGAGTATAAGAAAGTATG
GACAGAACTACAGGAAGCAATTGAAAAATCCGGTTATTCTCCTGATACGAGCGTGGTGCTTCATGATGTTGATGAAGAAA
CTAAGGCAAATTGGGTTTGTGGACACAGCGAAAGACTCGCGGCAACCTACTCCCTAATTCACACAGGTGAAGGGGTTCCA
GTTAGGGTTACCAAGAATCTCAGAGTATGTGCAGACTGCCATTCATGGATGAAGATTGTATCGCAAGTAACTGGGAGAGT
TATAGTCCTCAGAGACACCAAACGATTCCACCATTTCGTTGCCGGCATTTGCTCATGTAAAGACTACTGGTGA