Details for Lyrate rockcress Locus 16053441

Position : sca3 ( 5`- 8458059 .. 8459149 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053441

Protein [Map View]
MTMMYDFSQDLLEEILSRVPVTSLRAVRSTCKRWNDIIKDPSFSKKYGGKGANEFLVIMLNDFRACLMSVNLHGILDNKD
LCIIVMAYILLCITNEDNTRLVVWNPYLEQTRWIQPINKFCKFDRYCMGYDNNNNNHKILRFFIRFGYIEYEIYNFMSNS
WSVPHTTTNWDISPYCSRGVSLKGNTYFIAQKKMEVEQVETERFGPLLPLPFHYSIGNLVILSTVREEQLAVLFKRCGAY
ETKIWITTKIEPNTVSWSNFVHGENSTNNTAYMIGEDGYCKEVDLGESKFCPSMWSYVPSCVQIQ*

DNA
ATGACTATGATGTACGATTTCTCGCAGGATTTGCTAGAGGAGATTCTCTCTAGGGTTCCAGTAACATCTCTGAGAGCAGT
GAGATCAACTTGCAAACGATGGAACGATATAATCAAAGATCCGAGCTTTTCAAAGAAGTATGGTGGTAAAGGAGCCAACG
AGTTTCTGGTAATCATGCTGAATGATTTTAGGGCTTGTTTAATGAGCGTCAATCTTCATGGCATCCTAGACAATAAAGAC
CTGTGTATCATTGTGATGGCTTATATATTGTTATGCATCACCAATGAGGACAATACTAGGCTCGTGGTATGGAACCCGTA
TTTGGAACAAACCAGGTGGATCCAACCCATCAACAAATTTTGCAAATTTGATCGTTATTGTATGGGCTACGATAACAATA
ACAACAACCACAAAATTTTGAGGTTCTTCATAAGGTTTGGCTACATTGAGTATGAAATCTACAATTTTATGTCTAATTCA
TGGAGTGTCCCTCATACAACTACCAATTGGGATATCTCGCCATATTGCAGTCGGGGTGTCTCCTTGAAAGGAAACACTTA
CTTTATTGCTCAGAAAAAAATGGAAGTGGAACAAGTAGAGACTGAGAGATTTGGACCGCTTCTTCCTCTTCCATTCCACT
ATTCTATTGGAAATTTGGTAATTCTATCTACTGTTCGAGAAGAGCAGCTTGCAGTGTTATTTAAAAGGTGTGGTGCATAT
GAGACGAAGATTTGGATTACAACAAAGATTGAGCCCAATACAGTGTCGTGGAGCAACTTTGTACACGGAGAAAATAGCAC
CAACAACACGGCTTACATGATTGGAGAGGATGGATACTGCAAAGAAGTGGATCTCGGAGAATCTAAGTTTTGTCCATCTA
TGTGGTCTTATGTTCCAAGTTGTGTGCAGATCCAGTAA