Details for Lyrate rockcress Locus 16053438

Position : sca3 ( 5`- 3526776 .. 3527724 -3` )
Annotation : [B2G] LHCB4.2 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16053438

Protein [Map View]
MAATSTAASASSIMGTRVVSDISSGSTRFTAWFGFGTKKAAPKKAKTVISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGL
GKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGV
TWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVVGYIEFQRNAELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAEI
KHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS*

DNA
ATGGCTGCCACTTCAACCGCCGCTTCTGCTTCTTCAATCATGGGTACCCGGGTGGTTTCCGACATTAGCTCCGGTTCAAC
CCGGTTCACAGCCTGGTTCGGATTCGGAACTAAGAAAGCCGCTCCTAAAAAGGCTAAGACGGTTATCTCAGACCGGCCTT
TATGGTTCCCAGGCGCAAAATCCCCAGAGTATCTCGACGGTTCACTGGTCGGGGACTACGGGTTCGATCCTTTTGGTTTA
GGTAAACCGGCAGAGTATCTCCAATTCGATTTGGACTCCTTGGACCAGAACCTCGCCAAGAACTTAGCCGGAGACGTGAT
CGGGACCCGTACCGAGGCGGTGGATCCCAAATCGACGCCGTTTCAGCCATACAGTGAAGTCTTCGGGCTACAGAGATTCA
GAGAATGTGAGCTGATTCACGGTCGGTGGGCAATGCTCGCCACTCTCGGCGCTATCACCGTAGAATGGCTCACCGGTGTT
ACTTGGCAAGACGCCGGCAAGGTAGAGCTAGTGGATGGATCGTCTTACTTAGGACAGCCATTGCCGTTCTCTATCTCGAC
ATTGATATGGATCGAAGTGTTAGTGGTCGGCTACATTGAGTTCCAACGAAACGCTGAGCTGGACTCAGAGAAGCGTTTGT
ATCCAGGAGGCAAGTTCTTTGACCCGTTAGGACTAGCATCTGACCCGGAGAAGAAGGCTCAGCTTCAGCTAGCTGAGATC
AAACATGCTCGTTTAGCCATGGTTGGATTCTTGGGTTTTGCTGTTCAGGCGGCTGCAACCGGTAAAGGACCCCTCAACAA
CTGGGCGACTCACCTTAGTGACCCACTTCACACCACCATTATCGATACCTTCTCTTCCTCTTGA