Details for Lyrate rockcress Locus 16053434

Position : sca3 ( 5`- 4429046 .. 4430886 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053434

Protein [Map View]
MCVRNLKKGDLCGVIFGCKFSTIKECYAKNLFGLPAPHMAYIKNIDPGLTLFLFNYSDRTLHGIFEAASEGKLNIDSKAW
SPNGTDPTPYPAQVKVRVRVRCEPLPEEKFSPVISENYKDEKMFWFELDRGQTNKLLRLFKPSPSVRAPPSISRDAVPPP
RKPIPTSSLAQIGDLGATRVDKWSSLFKSSDESTENKEKDSKEGALGAGSRLVNLGKTKEWETASNNADERRTQPSVSQS
GTSYSSALKNMTASSTLEKKTSLTNEVSSQACKGVENHWTSASRVPSFRQDSGTFRNASKEGDDVKVNAYHHQQNLHPTQ
KGTSTTANNRIGTSISKEDPAEDTYSVIDWDAASSFQVHLDGLNKILEDPKDKDCFKSFAGNTGQASSSVVPNCWEDDFE
ERSIAKSPCGSSYVSAATGDVVDDIGRMDNFKVEIGSPTVVDILTELLAEVKELKHTQMKQAERMITLEMEQLESRREIL
RLKGSNGSL*

DNA
ATGTGTGTGAGAAATCTGAAGAAGGGAGATCTTTGTGGGGTTATATTTGGATGCAAGTTCAGCACTATCAAAGAGTGCTA
TGCTAAGAATTTGTTTGGTTTACCAGCCCCACACATGGCTTATATCAAGAACATTGATCCCGGCTTGACGCTGTTCCTAT
TCAACTACAGTGACAGAACACTTCACGGCATATTTGAAGCTGCTAGTGAAGGAAAACTGAACATTGATTCCAAAGCTTGG
TCTCCAAATGGGACAGATCCAACTCCATATCCTGCTCAGGTAAAGGTACGAGTCCGAGTGCGGTGTGAGCCCTTACCTGA
AGAAAAGTTCAGCCCCGTAATTTCTGAGAATTACAAGGACGAAAAGATGTTTTGGTTTGAACTAGACCGAGGTCAGACAA
ACAAGCTGCTCCGTTTGTTTAAACCATCACCATCTGTAAGGGCACCACCATCGATATCAAGAGATGCTGTACCACCACCC
AGAAAGCCTATTCCGACATCTTCTCTTGCACAGATAGGTGACTTGGGAGCAACACGTGTTGATAAGTGGAGCAGTCTGTT
CAAATCTTCCGATGAGTCTACCGAAAACAAAGAAAAAGACTCAAAAGAAGGTGCACTCGGAGCAGGTTCAAGATTAGTCA
ATCTTGGAAAAACTAAAGAATGGGAAACAGCTTCCAATAATGCAGATGAGCGAAGAACTCAACCATCAGTGTCACAGTCT
GGTACATCTTACTCATCAGCTCTGAAAAACATGACCGCTTCTTCAACTCTGGAGAAGAAAACTTCTTTGACAAATGAAGT
TTCATCTCAAGCATGTAAAGGTGTTGAAAATCATTGGACATCGGCTTCTCGAGTTCCATCTTTCCGCCAAGACAGTGGAA
CTTTCAGAAATGCTTCAAAGGAAGGTGACGATGTCAAAGTGAATGCTTATCATCATCAACAAAATCTCCATCCAACACAA
AAGGGAACCTCTACTACAGCTAACAATAGAATAGGAACTAGCATTAGCAAGGAAGATCCTGCTGAGGATACATATTCAGT
CATCGATTGGGATGCAGCATCTTCCTTTCAAGTCCATCTGGATGGATTGAACAAGATTTTGGAGGATCCTAAGGATAAGG
ACTGTTTCAAGAGCTTTGCGGGTAACACAGGACAAGCTTCTTCATCTGTAGTGCCTAATTGTTGGGAGGATGACTTTGAG
GAAAGAAGTATAGCTAAATCGCCTTGTGGATCTTCGTATGTTTCCGCCGCTACAGGAGACGTGGTTGATGACATCGGCCG
TATGGATAATTTCAAGGTGGAAATTGGATCTCCCACTGTTGTGGATATATTGACTGAGCTATTGGCGGAAGTCAAGGAGT
TGAAGCATACTCAGATGAAACAAGCCGAGAGGATGATTACTTTGGAGATGGAGCAGCTTGAATCAAGAAGGGAGATACTT
CGGCTAAAAGGGAGCAATGGAAGTCTTTAA