Details for Lyrate rockcress Locus 16053384

Position : sca3 ( 5`- 4311561 .. 4316408 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053384

Protein [Map View]
MPRLDVATVMPRLDVASVSAAKFGFQPTNKFLRSLSSVRCLDLALKEVACCSAINFPRLIEFMLRTYYSDNWLKPLMLLL
HNAPKLKALKITSCSCEIPDGYEDEKSNPEKSVWDFLDKSLQLHKAPSLESLRINLGQQCPVDVDVGKWVLNAVDRFVRE
LILQIRFIPTLTYTDLASRDSIDESDRSLVSDSPGLNYVYIFDTGGDDCTIQNMPHLDVAILLVGSYPTNKFLRSLSSVR
CLDLSLNEVACCSAINFPRLIEFKLHTGFSDNWLEPFMLLLHNAPKLKALMITSWIAFDDVCYHVQVTVKNPNLLLLVVS
LPNPPPEAMSFDGLPLGAIEASQRSTMAITISLSVEHFVFSFITCT*

DNA
ATGCCTCGCCTTGATGTGGCAACTGTGATGCCTCGCCTTGACGTGGCATCCGTGAGCGCTGCTAAATTTGGTTTTCAACC
GACTAACAAGTTTCTGAGATCTTTGTCCTCAGTCAGGTGTCTAGATTTGGCTTTGAAAGAGGTTGCGTGTTGTAGTGCCA
TTAACTTCCCTCGGCTCATAGAGTTTATGCTGCGTACATATTATTCAGACAATTGGTTGAAACCACTTATGCTTTTGCTT
CACAACGCTCCTAAACTAAAAGCTCTTAAGATAACCTCTTGCTCTTGCGAAATACCAGATGGCTACGAAGACGAGAAGAG
CAACCCCGAGAAAAGTGTTTGGGACTTCCTTGACAAGTCATTACAACTCCACAAGGCACCTTCACTAGAAAGCTTGCGTA
TCAATCTGGGACAACAATGTCCGGTTGATGTGGACGTCGGAAAGTGGGTCTTAAATGCGGTTGACCGTTTCGTTCGAGAG
CTAATTCTACAGATTAGATTTATACCAACATTGACGTATACGGATTTGGCATCACGTGACAGTATTGATGAGTCTGATAG
GTCCTTGGTTTCAGATTCTCCGGGCTTAAATTACGTTTACATCTTTGACACAGGAGGAGACGATTGTACGATTCAGAATA
TGCCTCACCTTGATGTGGCAATTTTGTTAGTTGGTTCTTACCCGACTAACAAGTTTCTGAGATCTCTGTCCTCAGTCAGG
TGTCTAGATTTGTCTTTGAATGAGGTTGCGTGTTGTAGTGCCATTAACTTCCCTCGGCTCATAGAGTTTAAGCTGCATAC
AGGTTTTTCAGACAATTGGTTGGAACCATTTATGCTTTTGCTTCATAACGCTCCTAAACTAAAAGCTCTTATGATAACCT
CTTGGATTGCATTTGATGATGTTTGTTACCATGTTCAGGTGACAGTGAAGAATCCAAACCTCTTGTTGCTTGTGGTTTCG
TTACCAAATCCACCACCTGAAGCAATGTCCTTTGATGGACTTCCATTAGGAGCTATAGAAGCCTCTCAGAGATCCACGAT
GGCTATTACAATTAGTTTAAGTGTCGAACACTTTGTGTTTTCTTTTATTACATGCACTTGA