Details for Lyrate rockcress Locus 16053379

Position : sca3 ( 5`- 2821195 .. 2821692 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477989 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16053379

Protein [Map View]
MESKLTSVDAIEEHSSSSSSNEGISNEKKSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKRRTLISNRSEDKKNKNH
NRNPKFGDSLKQRLMELGREVMMQRSTAENQRRKKLGEEEQAAVLLMALSYASSVYA*

DNA
ATGGAAAGCAAACTCACATCAGTAGATGCGATCGAAGAACACAGCAGCAGCAGTAGCAGTAATGAAGGTATCAGCAACGA
GAAGAAGAGTTGTGCCATTTGTGGTACTAGCAAAACCCCTCTTTGGCGAGGCGGTCCCGCCGGTCCCAAGTCGCTATGTA
ACGCATGCGGGATCAGAAACAGGAAGAAGAGAAGAACACTGATCTCGAATAGATCAGAAGATAAGAAGAACAAGAATCAC
AACAGAAATCCAAAGTTCGGTGACTCGTTGAAGCAGCGACTAATGGAATTGGGGAGAGAAGTGATGATGCAGCGATCAAC
GGCTGAGAATCAACGACGGAAGAAGCTCGGCGAAGAAGAGCAAGCCGCCGTGTTACTCATGGCTCTCTCTTATGCTTCTT
CCGTTTATGCTTAA