Details for Lyrate rockcress Locus 16053347

Position : sca3 ( 5`- 5855534 .. 5853650 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053347

Protein [Map View]
MASLTPRVLIKLLETMNTNIKVRGEYRSVLLQVISIVPALAGAELWPNQGFFIKVSDSSHSTYVSLRNEDNELILNNKLG
LGQFFYVDKLEAGTPVPVLVGVRPISGRHPFVGNPKDLMQMLVPSETTPLQEENHNQKKKDGARSKMVENTRKHQPFVIK
EEKTGVASRYMKGIVSNSKASGSDSSSGGSNNESETGSIMVAKKAGGLAKGKQREHKDQARQANPPQSRPATAPTKAESK
KLSLSSTVNYINRKSNSSEDASWSSLPASLSKLGKGILRRRNIAALIATEAQREALVASHLIKCISMFADLSSNASPKNP
NTSLRNFFTLQSILDQAQVTVAASKDKSFQPVNIHSLWTEPEKLSKKTSLASSRTTTKSSKTLTEAEKLEWVKGNGTEEI
KELRNTLKRETRSWFLKFLEDALDTGLHASVPEKKGKTKGARLAEPDNHIAETLSQLKQANEWLEKVKNDNLSSDNSLLE
NIERLKKKIYSCLLLYVDSAASAIGV*

DNA
ATGGCTTCTCTTACGCCTAGAGTGTTAATCAAGCTTCTCGAGACGATGAACACCAACATCAAGGTTCGAGGCGAATATAG
GTCTGTTCTGTTGCAGGTAATCAGCATTGTCCCTGCTTTAGCCGGCGCAGAGCTTTGGCCAAACCAAGGCTTTTTCATCA
AAGTGTCAGATTCTTCTCACTCCACATATGTCTCGTTGAGGAACGAAGACAACGAACTTATCTTGAACAACAAATTGGGA
TTGGGACAGTTCTTCTACGTTGATAAGCTTGAAGCTGGAACACCTGTTCCTGTATTGGTGGGAGTTAGACCGATTTCTGG
ACGCCATCCTTTTGTAGGAAATCCCAAAGATTTGATGCAAATGTTGGTACCTAGTGAGACAACACCTCTGCAAGAAGAAA
ATCACAACCAGAAGAAGAAAGATGGTGCGAGATCAAAAATGGTTGAGAATACACGAAAACATCAACCTTTTGTAATCAAG
GAAGAGAAGACAGGTGTGGCGTCAAGATATATGAAGGGTATTGTTTCAAATTCAAAGGCAAGTGGATCAGACTCGAGTAG
TGGCGGTAGCAACAATGAGTCTGAGACTGGATCGATAATGGTTGCTAAGAAAGCTGGTGGATTGGCTAAGGGGAAACAAA
GGGAGCACAAAGATCAGGCACGTCAAGCTAATCCTCCACAATCTCGGCCTGCGACAGCTCCAACAAAGGCAGAGTCAAAG
AAACTCTCTTTGAGCTCCACTGTGAACTACATAAACAGAAAGAGTAATTCTTCTGAGGATGCATCATGGAGCTCTCTGCC
TGCTAGTCTATCAAAATTGGGTAAAGGAATTCTGAGAAGGAGAAATATAGCTGCTCTAATTGCCACAGAAGCGCAAAGAG
AGGCATTGGTTGCTTCACATCTTATCAAATGCATCAGTATGTTTGCTGACCTCAGCTCAAATGCTTCACCAAAGAATCCA
AATACCTCTCTCAGAAACTTCTTCACCCTCCAGAGTATCCTTGACCAAGCACAGGTCACAGTTGCAGCATCGAAAGATAA
ATCATTCCAGCCAGTGAATATTCATTCATTATGGACAGAACCTGAAAAGTTAAGCAAAAAAACTAGCCTAGCTTCAAGCA
GAACCACAACAAAGTCTTCAAAAACTCTAACAGAAGCCGAAAAGCTAGAATGGGTTAAGGGAAATGGCACAGAAGAGATA
AAAGAACTGAGAAACACTTTGAAACGAGAAACAAGAAGCTGGTTTTTGAAATTCTTGGAAGATGCATTAGATACTGGATT
ACATGCTAGTGTTCCGGAGAAGAAAGGAAAAACCAAAGGAGCGCGACTAGCGGAACCAGATAATCATATTGCTGAGACAT
TATCCCAACTTAAGCAAGCAAACGAATGGCTGGAAAAAGTTAAAAATGATAATCTCTCTAGTGATAATTCTTTGTTAGAG
AATATAGAACGATTGAAGAAGAAAATATACTCTTGCTTGCTACTTTATGTAGATTCAGCTGCATCAGCTATTGGAGTATA
G