Details for Lyrate rockcress Locus 16053309

Position : sca3 ( 5`- 5751208 .. 5752343 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053309

Protein [Map View]
MEINGQEGHRHEESSSEWFVKYLKHQGDWLEKTRGNLMVTATVIAGMSFQVMVNPPGGVWQSDNCSFGNQTGTAPVCKGK
AGTAVLEYESSKRIAYLGMVISSTVSFSASMSLILLVISGIRLRNRMIMAILVTFMVVAVLCISAAFFFTIVLVQSDDQI
IRDILLIYVGFWVIFPVLILLIQLVRFIGWLICFMCCCCCQRRRRSPQRLLPLAPSPAN*

DNA
ATGGAGATCAACGGTCAAGAAGGTCATCGACACGAAGAATCATCATCAGAGTGGTTCGTAAAGTATCTAAAACATCAAGG
CGATTGGTTAGAGAAAACTAGAGGGAATCTTATGGTTACAGCTACGGTTATAGCTGGTATGAGCTTTCAAGTTATGGTTA
ATCCTCCTGGTGGCGTATGGCAAAGTGACAATTGTTCTTTCGGAAATCAAACCGGAACCGCACCGGTTTGTAAAGGAAAA
GCAGGAACTGCGGTATTGGAGTATGAGAGTTCAAAGCGTATAGCCTATCTTGGGATGGTTATTAGCAGTACAGTGTCGTT
TTCTGCCTCAATGAGTCTCATTCTCCTTGTCATCAGCGGTATACGACTAAGGAACCGAATGATAATGGCGATCCTCGTAA
CATTTATGGTAGTGGCGGTTCTTTGTATATCGGCGGCGTTCTTCTTCACCATCGTGCTGGTTCAGTCCGATGATCAGATA
ATTCGTGATATACTACTGATATATGTGGGATTTTGGGTCATATTTCCTGTTTTAATACTTTTAATCCAACTTGTTCGATT
TATAGGTTGGCTTATTTGTTTCATGTGTTGTTGTTGTTGTCAACGTCGGCGACGGTCCCCTCAACGGTTGTTGCCACTGG
CTCCATCTCCGGCCAATTAA