Details for Lyrate rockcress Locus 16053302

Position : sca3 ( 5`- 5454120 .. 5454452 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053302

Protein [Map View]
MMVKFCLIASLLVLSLAISSYVVLAQSKEETIGETKHIRKIMKIRAPRSKSPPDRQWGESDSPQAAGPNSV*

DNA
ATGATGGTCAAGTTCTGTTTGATTGCTTCGCTTTTGGTTCTCTCTTTGGCGATTTCATCGTACGTCGTTTTAGCACAATC
CAAAGAAGAAACAATAGGAGAAACGAAACACATTCGAAAGATAATGAAGATCAGAGCACCTCGTAGTAAGTCGCCACCCG
ATCGCCAATGGGGTGAGAGTGACTCGCCCCAAGCCGCAGGTCCAAATTCAGTCTAA