Details for Lyrate rockcress Locus 16053258

Position : sca3 ( 5`- 4458152 .. 4457277 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053258

Protein [Map View]
METTPETQSKTHQSGSNRLPAGREDWWSEDATATLIEAWGDRYVNLNRGNLRQNDWKEVADAVNSSHGNGRPKTDVQCKN
RIDTLKKKYKTEKAKPLSNWCFFDRLDFLIGPVMKKSSGGVVKSAFMNPNLNPTGSKSTGSSLDDDDDDDDDDEEDDDDA
GDWGFVVRKHRKVEDVDPSEGSAFRELARSILKLGEAFERIEGKKQQMMIELEKQRMEVAKELELQRMNMLMEMQLELEK
SKLGKRRAASGKKL*

DNA
ATGGAGACGACGCCGGAGACTCAGTCCAAGACTCACCAGAGCGGGTCTAACCGTCTACCGGCGGGAAGAGAGGATTGGTG
GAGCGAAGACGCGACGGCGACATTGATCGAAGCTTGGGGAGATCGTTACGTCAATCTCAACCGTGGGAATCTCCGGCAAA
ACGATTGGAAAGAAGTCGCCGACGCCGTTAATTCTAGCCACGGGAATGGCCGGCCAAAGACCGACGTGCAGTGCAAAAAC
CGGATCGATACGTTGAAGAAGAAGTACAAAACTGAAAAGGCGAAACCTTTATCGAATTGGTGCTTCTTTGATAGACTCGA
TTTCTTAATCGGTCCGGTTATGAAGAAATCGTCCGGTGGCGTTGTTAAATCGGCTTTTATGAACCCTAATTTGAATCCTA
CTGGATCTAAATCAACTGGAAGCTCTCTTGACGACGATGATGATGATGATGATGATGACGAAGAAGATGATGATGATGCG
GGTGATTGGGGATTTGTGGTGAGGAAGCATCGTAAAGTTGAAGATGTAGATCCGAGTGAAGGATCAGCCTTTAGGGAATT
AGCGAGGTCGATTCTGAAGTTAGGGGAAGCGTTTGAAAGAATCGAGGGTAAGAAGCAACAGATGATGATTGAATTGGAGA
AGCAGAGAATGGAAGTTGCAAAGGAGCTTGAGTTACAACGAATGAATATGTTGATGGAGATGCAATTGGAGCTTGAGAAA
TCTAAACTTGGGAAACGAAGAGCTGCTTCAGGTAAGAAGTTGTAG