Details for Lyrate rockcress Locus 16053257

Position : sca3 ( 5`- 8284923 .. 8286284 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053257

Protein [Map View]
MFRLYPNCSLPSHRPLVFLHRLPSRSLRCRAAADIPLGDGIRLPREADSTSDTARSRDVSVAAGGNGEGAKWRKRRLLWS
KSGESYLVDDGDALPLPMTYPDTSPVSPDVIDRRLQCDPVVEDCREVVYEWTGKCRSCQGSGTVSYYKKRGKEVICKCIP
CQGIGYVQKITSRTDIEVMEDLDNEPS*

DNA
ATGTTCCGATTATACCCTAATTGCTCTCTACCTTCTCACAGACCTCTCGTTTTCCTTCACCGTCTTCCTTCTCGCTCCCT
CCGTTGCCGCGCCGCTGCTGATATTCCCCTTGGCGACGGAATCCGGTTACCTCGAGAAGCGGATTCAACCTCTGACACGG
CGAGGTCTCGGGATGTTTCCGTCGCCGCCGGCGGGAATGGTGAAGGTGCAAAGTGGAGGAAGAGGAGGTTGCTCTGGTCC
AAAAGTGGGGAGAGTTACTTGGTAGATGATGGTGACGCGCTTCCTCTTCCTATGACTTATCCTGATACATCCCCTGTGTC
GCCGGATGTGATTGACCGGAGGTTGCAATGTGATCCTGTAGTCGAGGATTGCCGGGAAGTGGTTTATGAATGGACTGGAA
AGTGTAGAAGTTGCCAAGGATCTGGAACTGTCAGCTATTACAAGAAAAGGGGTAAAGAGGTTATATGCAAGTGCATACCC
TGCCAAGGGATAGGATATGTGCAGAAGATAACATCTCGGACGGACATTGAAGTGATGGAAGATTTGGATAATGAACCATC
CTGA