Details for Lyrate rockcress Locus 16053235

Position : sca3 ( 5`- 2920642 .. 2918332 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053235

Protein [Map View]
MNRLRWVEEGDIWDLDMSTPATLEGIARAVPDDPLPLGLSRGTRLSRPKQVEFFHRFMTSPLIPSFSPIRPNTGDGGCGG
FSLQRVLTLPFSNNWLVSLLGQFDVQRFVSEIEKTKTFGRGSSSTVASRLNTIGKHLKDKSLYALGFCSEFLLSPDDTLL
LSYDTYKGDLEKNPRAKAIFNHEFPLHNLTAEAAWPGLFVDKHGEYWDVPLSMAIDLASLPAESGPSYHVCLHHNSGAPK
KLNSDTMEVPPPSLLPGLSLKSAVSYRTNMDLWRGTTPKLETCKPYDVFLSSPHVAVSGIIGSVMTAAFGENSIRSKSEN
DSEGVGGFSLHFPSVNSGFMADALGRASLTAQYGNFQKPFFDLTRFHARLDYPHGLRFLTGATSVAHDLLNSRQPSLEAF
QKICPEVLVSLQQQIVGPFSFKVESGIQIDLKNGANPVTVDKTVFAIEYALQVLLSAKAVAWYSPKQKEFMVELSFFET*

DNA
ATGAATAGACTGAGATGGGTCGAAGAGGGAGATATCTGGGACCTCGACATGTCAACTCCGGCAACACTCGAGGGTATCGC
ACGAGCTGTTCCCGACGATCCTCTTCCTCTAGGTCTCTCTAGAGGCACTCGTCTCTCTCGCCCTAAGCAAGTTGAGTTCT
TCCACCGCTTCATGACCTCACCTCTCATCCCTTCCTTCTCCCCTATCCGTCCCAACACCGGAGATGGAGGCTGTGGTGGA
TTCTCTCTTCAAAGAGTCCTCACTCTTCCTTTCTCCAACAACTGGCTTGTGTCTCTTCTGGGCCAATTCGATGTTCAGAG
ATTCGTATCGGAGATAGAAAAGACTAAAACTTTTGGTCGAGGGTCTTCGTCTACAGTAGCTTCTCGTTTAAACACAATTG
GCAAGCATTTGAAGGATAAATCTTTGTACGCATTGGGTTTTTGTTCTGAGTTCTTGTTATCACCAGATGATACTTTGCTT
CTTAGCTACGATACTTACAAAGGTGATCTTGAAAAAAATCCTAGGGCTAAGGCTATCTTCAATCACGAGTTCCCGCTTCA
CAATCTGACAGCAGAAGCGGCTTGGCCTGGACTTTTTGTGGATAAACATGGTGAATATTGGGATGTGCCACTCTCAATGG
CTATTGATCTAGCATCTCTTCCTGCTGAGTCTGGTCCAAGTTACCATGTATGTTTACACCATAACAGTGGAGCACCCAAG
AAGTTAAATTCGGATACTATGGAAGTGCCTCCACCGTCACTGCTTCCTGGTTTGTCTCTGAAATCCGCAGTTTCTTATAG
GACAAACATGGATCTCTGGAGGGGTACCACTCCAAAGCTCGAAACTTGCAAGCCCTATGACGTCTTCCTCAGTAGTCCTC
ATGTCGCTGTATCTGGGATTATCGGCTCTGTGATGACCGCAGCATTTGGTGAAAATTCAATCAGATCAAAATCTGAGAAT
GATTCTGAGGGTGTTGGAGGGTTCTCTCTTCATTTTCCATCTGTAAATTCCGGATTCATGGCTGATGCCTTAGGGCGGGC
ATCACTCACAGCTCAATATGGAAACTTCCAGAAGCCCTTCTTTGATCTCACCCGTTTCCATGCTAGATTAGACTATCCGC
ATGGTTTGAGGTTTCTTACCGGTGCCACTAGCGTCGCACACGATCTTTTAAATTCTCGGCAGCCTAGTTTAGAAGCATTT
CAGAAAATCTGCCCTGAAGTATTAGTTTCTCTACAGCAACAGATTGTTGGACCGTTTAGTTTCAAAGTGGAGTCTGGAAT
TCAGATTGATCTGAAGAACGGAGCTAACCCCGTGACTGTAGATAAGACAGTATTTGCTATTGAATATGCTCTACAAGTGC
TTCTTTCTGCCAAGGCTGTTGCTTGGTACTCCCCAAAACAGAAAGAATTCATGGTTGAGCTTAGTTTCTTTGAGACATAG