Details for Lyrate rockcress Locus 16053207

Position : sca3 ( 5`- 715316 .. 717882 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053207

Protein [Map View]
MEVSNQTRKRKAIDAGHGSPPPAYRGSDSVDLSLLEALEKSSHHAVEALDLKTLKKLVLSFERRLRDNIAARLKYVENPE
KFADSEVDLHDDLQKLKVLAGAPELYPDLVASNSVPSIVNLLSHDNSDIANDVVQLLQDLTDEDALEDNDEPARVLVDAL
VENNVLELLVQNMNRLSEADPDEATAIYATLTVIENLVEVKPAVAELVCERTKLLRWLLTKIKVREFEGIKQYASEILAI
LLQNSTANQKRLGQMNGVDAVLEGVAMYKSKDPKTPDEEEMLENLFDCLCCLLMPLENKERFVNAEGVELMIIIMKQKKY
AYGSAIRALDFAMTNYPPACERFVDVMGLKTAFAAFMGKIPLNKRIKRERYKEELEERVISLIASLFAGILRGSRRDRLL
SKFVENEFEKIDRLMELYFRYSDRVRSEAERLDQLELDDLELDEDEKYNRKLESGLYSLQLVAVILGHIWCSEHSGMRGR
IELLLKQQKLSKTDVKQILQEYHDNIGDLDGPEEKERGQARIQLFISAM*

DNA
ATGGAAGTCTCAAATCAGACCAGAAAACGGAAAGCAATCGACGCCGGACATGGCTCGCCGCCGCCGGCGTATCGAGGCTC
AGATTCTGTAGATCTTTCTCTCCTTGAAGCACTTGAGAAGTCTTCGCATCATGCAGTAGAAGCGCTTGATCTTAAAACCC
TAAAAAAGCTTGTCCTCTCCTTCGAGCGGCGTCTTAGGGACAACATAGCTGCTCGTCTCAAGTATGTGGAGAATCCAGAA
AAGTTCGCTGACTCAGAGGTTGACCTACACGACGATCTTCAGAAGCTAAAGGTTCTCGCTGGAGCTCCGGAGCTTTACCC
TGACCTTGTTGCTTCCAATTCGGTTCCTTCGATTGTTAACCTCCTCTCCCATGATAACTCCGACATCGCCAACGATGTTG
TTCAGCTTCTTCAGGATCTGACTGACGAAGATGCATTAGAGGATAACGATGAGCCGGCGCGTGTGTTAGTCGACGCACTG
GTTGAAAACAATGTGCTCGAGCTCTTGGTTCAGAATATGAATCGTTTGTCTGAGGCAGACCCAGACGAAGCTACGGCTAT
ATACGCAACTTTGACAGTGATTGAGAATTTGGTGGAAGTAAAGCCGGCTGTTGCTGAATTGGTGTGTGAACGGACGAAAC
TATTGCGGTGGCTTCTGACGAAGATTAAGGTGAGGGAATTCGAAGGGATCAAGCAGTACGCGTCTGAGATTCTTGCAATT
CTGCTGCAAAACAGCACGGCGAATCAGAAACGGCTAGGTCAGATGAATGGTGTAGATGCTGTGCTTGAAGGTGTGGCGAT
GTATAAGTCGAAGGATCCTAAAACTCCTGATGAGGAAGAGATGTTAGAGAATCTATTTGATTGTTTGTGTTGCCTCTTGA
TGCCATTGGAGAACAAGGAGAGGTTTGTGAATGCGGAAGGTGTTGAGCTGATGATTATTATCATGAAGCAGAAGAAATAT
GCTTACGGGTCTGCAATTCGAGCTCTAGACTTCGCCATGACCAATTATCCACCAGCTTGTGAGAGGTTTGTGGATGTTAT
GGGACTGAAAACAGCATTTGCTGCTTTCATGGGTAAGATTCCGCTAAACAAGAGGATCAAAAGGGAGCGGTATAAAGAGG
AGCTAGAGGAGCGGGTTATTTCCCTTATTGCGTCATTATTTGCTGGGATTTTAAGGGGTTCTAGGAGAGATCGTTTATTA
AGTAAGTTTGTGGAGAATGAGTTTGAGAAGATTGACCGGCTCATGGAATTATATTTCAGATACTCTGATAGGGTTAGATC
AGAGGCGGAGAGGTTAGACCAGCTTGAGCTTGATGACCTTGAGTTGGATGAAGATGAGAAATATAACCGGAAGCTAGAAT
CAGGGCTCTATAGTCTTCAGCTTGTTGCTGTCATCCTGGGCCATATTTGGTGTTCTGAGCATTCTGGGATGAGAGGGCGG
ATCGAGCTGCTACTGAAGCAACAGAAGCTTAGTAAAACCGATGTCAAGCAGATTCTTCAGGAATATCACGACAACATTGG
AGATCTTGATGGACCAGAGGAGAAGGAACGAGGACAGGCAAGAATTCAGTTGTTCATATCGGCAATGTGA