Details for Lyrate rockcress Locus 16053180

Position : sca3 ( 5`- 1841547 .. 1834817 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053180

Protein [Map View]
MEDSSSTASNVARAILAVVDYSSTSDTRKSAVEFLDSIKSGDVRVLANTSFHLVKKEWSSEIRLHAFKMLQHLVRLRWDE
LSPPECRDLVNVSVELMSEVANACENWPLKSQSAALVAEIVRREGPDVWQKIFTLLTSLSAQGPLQAELVLMTLRWLPED
ITIYNDDLEGDRRRLLLRGLTQSLPEILPLLYNLLERHFGAAMSEAGRQQYDLAKQHADVVIACLNAIIAYTEWAPVPDL
ARYGILSGCSFLLSSPDFRLHACEVFKLVCSRKRPSDASNAEFDSAISNLFQILTNASRELLCRSSSSSSVIDENDYDFA
VCLCESMASLGSTNLQCISSDGGVMAVYLQQMLGFFQHFKLGLHFEALLFWLSLMRDLLPKPKAAAYPSGGGSSTGGVDS
SSQVDSEKKKTLSLINDDISSVILDVSFQRMLKKEKVPTGIALSLGPLELWSDEFEGKGDFGPYRSKLLELIKLTASHKP
LISSTKISERVITLIKHLLASPAPLQDVAVMDSQQLALDCIVATLFDGSNEFAGGSSEVHYALRGIFEGLLQQLLSLKWN
EPELMKVHVHYLDAMGPFLKYFPDAVGSVINKLFELLTSLPHVVKDPATSTSRAARLQICTSFIRIAKAAEKSVLPHMKG
IADTMGYLTKKGTLLRGEHNILGEAFLVMASSAGAQQQQEVLAWLLEPLSQQWIQPEWQNNYLSDPMGLVRLCSNTSFMW
SIFHTVTFFEKALKRSGYRKSNLNTTSVTTPASHPMAHHLSWMLPPLLKLLRVLHSLWSPSVFQTLPPELRAAMTMTDAE
RCSLLGEANPKLSKGTSVYADGSFDGNKEGQVEASESDIRNWLKGIRDCGYNVLGLSTTIGETFFKCLDPNYVAMALMEN
LQSMEFRHIRLFIHTFITYIVKSCPADMWESWLGVLLHPLFIHCQQALSSAWPGLLQEGRAKVPDLFGIQSGSDMKLEVM
EEKLLRDLTREIATLFSTMASPGLNTGVPVLEHSGHVGRVDMSTLTDLHAFRSNSMVGFLLNHKSVALPALQICLETFTW
TDGEATTKVCYFCGVVVLLAKLTNNVELREFVSKDMFSAVIRGLGMESNAINSPDLVNICREIFIYLSDRDPAPRQVLLS
LPCLTPNDLHAFEEAAAKTTSPKEQKQLMRSLLLLGTGNNLKALAAQKNLNVITNVTARSRLPASASETIGAGVLWEEEL
LQ*

DNA
ATGGAAGATAGCAGCTCCACGGCGAGTAATGTGGCCCGAGCTATTCTCGCCGTCGTCGATTATAGCTCCACGTCCGACAC
TCGCAAATCGGCGGTCGAATTCCTGGATTCTATCAAATCTGGAGATGTCAGGGTTTTGGCAAATACTTCTTTTCATCTTG
TGAAAAAAGAGTGGTCTTCAGAAATTCGTCTCCATGCTTTTAAGATGCTACAGCATTTGGTTAGACTACGATGGGACGAA
TTAAGTCCTCCGGAGTGCAGGGATCTTGTTAATGTTTCTGTCGAACTAATGTCAGAGGTTGCTAATGCATGCGAGAATTG
GCCTCTTAAGAGTCAGTCTGCTGCCCTTGTAGCTGAGATAGTTAGAAGAGAAGGCCCTGATGTTTGGCAAAAGATATTTA
CTTTATTAACTTCATTGTCTGCTCAGGGCCCCTTACAAGCTGAATTGGTCTTGATGACGCTGAGATGGCTTCCTGAAGAT
ATTACAATTTACAATGACGACTTAGAAGGTGACAGGCGTAGGCTACTGTTGCGGGGACTTACTCAATCTCTGCCTGAGAT
TTTGCCTTTATTGTATAATCTTCTTGAGAGACACTTTGGAGCTGCAATGAGTGAAGCTGGTAGGCAGCAGTATGACTTGG
CAAAACAGCATGCAGATGTGGTTATAGCTTGCTTGAATGCCATTATTGCATACACTGAGTGGGCTCCTGTTCCAGATCTT
GCCAGATATGGAATTCTTAGTGGGTGCAGCTTCTTACTTTCTTCTCCTGACTTCCGTCTTCATGCTTGTGAGGTTTTCAA
ACTCGTCTGCTCAAGAAAAAGACCCAGTGATGCTTCTAATGCAGAGTTCGATTCTGCAATTAGCAATTTGTTTCAGATCC
TGACGAATGCCTCGAGAGAATTATTATGTAGATCCTCCTCAAGTTCTAGCGTTATAGATGAAAATGATTATGATTTTGCT
GTATGCTTGTGTGAGAGTATGGCCTCTTTAGGCTCAACTAACTTGCAATGCATCTCTTCTGATGGTGGTGTTATGGCTGT
TTATCTTCAGCAGATGCTTGGCTTTTTCCAACACTTCAAGTTGGGCCTTCACTTCGAGGCACTTCTCTTTTGGCTGTCAT
TGATGCGGGATTTACTTCCAAAGCCTAAGGCTGCGGCTTATCCAAGTGGTGGGGGATCATCAACTGGCGGTGTAGATAGT
TCAAGCCAGGTTGATAGTGAAAAGAAAAAGACTTTAAGTCTTATTAATGATGACATCTCTAGCGTTATACTGGATGTATC
TTTCCAGCGGATGCTCAAGAAAGAAAAAGTTCCTACTGGAATTGCTCTTTCGCTTGGGCCCCTAGAACTCTGGAGTGATG
AATTTGAAGGGAAGGGAGACTTTGGCCCGTACCGATCAAAGCTTCTAGAATTGATCAAGCTTACTGCTTCTCACAAGCCT
CTCATCTCCAGTACCAAAATATCTGAAAGGGTGATTACACTCATTAAGCACCTATTGGCTTCTCCAGCACCTCTTCAGGA
TGTAGCAGTGATGGACAGCCAGCAGTTAGCACTTGACTGTATTGTGGCAACGCTTTTTGATGGATCAAATGAGTTTGCTG
GTGGAAGTTCTGAAGTTCATTATGCATTACGTGGAATATTTGAGGGATTGCTTCAGCAGCTTCTCTCTTTGAAATGGAAT
GAACCAGAACTTATGAAAGTGCATGTGCACTATCTGGATGCAATGGGTCCCTTTCTCAAGTATTTTCCAGATGCAGTTGG
AAGTGTCATCAATAAATTATTTGAGCTTCTCACCTCTCTTCCACACGTTGTGAAGGATCCAGCTACTAGTACATCTAGAG
CTGCAAGATTGCAGATTTGCACATCTTTCATAAGAATAGCCAAAGCTGCAGAGAAAAGTGTTCTGCCTCACATGAAGGGT
ATTGCTGATACAATGGGGTATTTGACAAAAAAAGGAACTTTACTCCGTGGGGAGCATAACATTCTGGGTGAAGCATTTCT
TGTTATGGCTTCCTCAGCAGGAGCTCAACAGCAGCAAGAAGTTCTAGCTTGGTTATTGGAACCATTGAGTCAACAGTGGA
TCCAACCAGAGTGGCAGAACAATTATCTATCAGACCCGATGGGTCTTGTTCGTTTATGCTCCAACACATCCTTCATGTGG
TCCATATTCCACACTGTTACATTCTTTGAGAAAGCACTCAAGCGAAGTGGATACAGAAAAAGCAATTTGAACACGACCTC
TGTGACAACTCCAGCTTCACATCCTATGGCTCATCATCTTTCTTGGATGTTGCCACCCCTCTTAAAACTACTCCGTGTTC
TTCATTCCCTTTGGTCTCCCTCTGTATTTCAAACATTACCCCCAGAACTGAGGGCAGCAATGACAATGACTGATGCTGAG
CGATGCAGTCTCCTTGGTGAAGCAAATCCTAAATTGTCAAAAGGTACATCGGTTTATGCTGATGGGTCATTCGATGGAAA
TAAGGAAGGACAGGTCGAGGCAAGTGAATCTGATATACGAAATTGGTTGAAAGGTATCCGAGATTGTGGATACAACGTGT
TGGGCCTATCAACAACCATCGGAGAGACATTCTTTAAATGCTTAGATCCTAACTATGTTGCGATGGCACTCATGGAAAAT
TTGCAGTCGATGGAATTCAGGCACATTCGGCTGTTCATTCATACGTTTATAACTTATATAGTCAAATCTTGTCCGGCGGA
TATGTGGGAGTCATGGCTCGGAGTGCTTCTGCACCCATTGTTTATTCACTGTCAGCAAGCTCTCAGCTCCGCCTGGCCCG
GTCTTCTACAAGAGGGCAGAGCAAAGGTTCCGGACTTGTTTGGCATACAAAGTGGATCAGACATGAAACTTGAAGTGATG
GAGGAAAAACTGTTAAGAGATTTAACTCGGGAGATTGCGACTCTCTTTTCAACAATGGCTTCTCCTGGACTAAACACAGG
AGTTCCAGTTTTGGAACATTCAGGACATGTGGGTCGTGTGGACATGTCTACTCTCACGGATTTGCATGCGTTCAGATCCA
ACTCTATGGTGGGTTTCCTCCTGAATCACAAAAGCGTAGCTCTACCAGCACTGCAGATATGTTTAGAAACCTTTACCTGG
ACAGATGGAGAAGCGACCACCAAAGTCTGTTACTTTTGTGGTGTTGTTGTTCTTCTAGCTAAACTAACAAATAACGTGGA
GCTCCGAGAATTTGTTTCAAAAGATATGTTCTCTGCAGTCATCCGCGGCTTAGGCATGGAGTCCAATGCCATTAACAGCC
CTGATTTAGTTAATATATGCCGTGAAATATTTATCTATCTCTCTGACAGAGACCCAGCTCCTCGCCAGGTTTTGCTTTCG
CTCCCGTGTCTCACTCCCAACGACTTGCATGCTTTTGAAGAAGCTGCAGCCAAAACTACCAGCCCCAAAGAACAAAAGCA
GCTTATGAGGAGCTTGTTGTTGTTAGGTACTGGGAACAACTTAAAAGCACTTGCTGCTCAAAAAAATCTGAATGTTATCA
CCAATGTCACAGCAAGATCGCGGCTACCCGCAAGCGCTTCAGAAACAATTGGAGCGGGTGTTTTGTGGGAGGAAGAGCTC
TTACAATGA