Details for Lyrate rockcress Locus 16053130

Position : sca3 ( 5`- 11012580 .. 11010509 -3` )
Annotation : [B2G] s1 rna-binding domain-containing protein
External links : CoGe
PGDD synteny : 16053130

Protein [Map View]
MAVFGGATTLGSVSFSSHLFDQQSCFLSCPLRLLPSSSSSSSPSHRNPLLCIVKSFSSSATADTDRNSDQSASSSVLSAS
NSLLRDTSNDAAGPSDWKTAKAYCKSGDTFEGEVEGFNGGGLLIRFHSLVGFLPYPQLSPSRSCKEPQKSIHEIAKTLVG
SKLPVKVVQADEENRKLILSEKLALWPKYSQNVSVGDVFTGRVGSVEDYGAFIHLRFDDGLYHLTGLVHVSEVSWDYVQD
VRDVLRDGDEVRVIVTNIDKEKSRITLSIKQLEDDPLLETLDKVILKDSSSGSPSLSSNNGDTIEPLPGLETILEELLKE
DGIEAVKINRQGFEKRVVSQDLQLWLSNTPPSDGKFVLLARAGRQVQEIHLTTFLEQGGIKKALQHVLERVP*

DNA
ATGGCAGTTTTCGGTGGCGCTACTACATTGGGTTCTGTATCTTTCTCTTCTCATCTCTTCGACCAACAATCTTGTTTCCT
CTCTTGCCCACTTAGACTCCTCCCTTCCTCTTCCTCATCCTCTTCTCCGTCACATAGAAACCCTCTCCTCTGCATTGTCA
AATCATTCTCAAGCTCCGCCACCGCGGATACAGATAGAAACTCCGATCAATCAGCCTCTTCCTCCGTCCTCTCCGCCTCC
AATTCTCTTCTCCGAGACACCTCCAATGATGCTGCTGGACCCAGTGATTGGAAAACGGCAAAAGCTTATTGCAAAAGTGG
TGATACATTTGAAGGTGAAGTTGAAGGCTTTAATGGTGGTGGCTTACTTATTCGTTTCCATTCTCTTGTGGGATTTCTTC
CTTATCCACAATTAAGTCCTTCACGTTCTTGTAAAGAGCCTCAGAAAAGTATTCATGAAATAGCTAAGACTTTGGTTGGT
TCTAAACTTCCTGTGAAGGTTGTTCAAGCTGATGAGGAAAATAGAAAGTTGATTTTATCTGAGAAGTTAGCATTATGGCC
AAAGTATTCACAAAACGTTAGTGTTGGAGATGTGTTTACTGGAAGAGTAGGTTCTGTTGAAGACTATGGTGCCTTTATCC
ACTTGCGTTTCGATGATGGTCTTTATCATTTAACCGGATTAGTGCATGTCTCTGAAGTATCGTGGGATTACGTTCAAGAT
GTTAGGGATGTACTACGCGATGGTGATGAGGTTCGGGTTATAGTCACGAATATTGACAAAGAGAAATCAAGGATTACACT
ATCTATCAAACAACTAGAAGATGATCCTCTTCTAGAAACATTAGACAAAGTGATTTTGAAGGACAGCTCTAGTGGATCTC
CTTCGCTAAGTTCGAACAATGGGGATACAATCGAACCTCTTCCAGGGCTAGAAACAATACTTGAAGAACTTTTAAAGGAA
GATGGAATAGAAGCTGTGAAAATCAACCGGCAAGGATTTGAGAAAAGAGTAGTTTCACAAGACCTACAACTTTGGCTCTC
AAATACACCACCTTCTGATGGGAAGTTTGTTCTTCTTGCCCGTGCTGGAAGACAGGTGCAAGAGATACACTTGACGACGT
TTCTGGAACAAGGAGGAATCAAGAAAGCACTTCAGCATGTACTAGAACGTGTCCCCTAA