Details for Lyrate rockcress Locus 16053115

Position : sca3 ( 5`- 9233701 .. 9235598 -3` )
Annotation : [B2G] ccaat-binding transcription factor (cbf-b nf-ya) family protein
External links : CoGe
PGDD synteny : 16053115

Protein [Map View]
MGIEDMHSKSDSGNKIDSEVHGTLSSSINSLNPWHRAAAACNANSCVEAGDKSSKSIALALESNGSKSPSNREDNVNKES
QVTTSPQSAGSDKNQESLHPGITQPPPHPQLVGPTVGWASSNPYQDPYYAGVMGAYGHHPLGFVPYGGMPHSRMQLPPEM
AQEPVFVNAKQYQAILRRRQARAKAELEKKLIKSRKPYLHESRHQHAMRRPRGTGGRFAKKTNTEASPRKAEEKSNGRVT
QSPTSSNSDQGEAWNVEYRTPQGDEMQSSAYKRREEGECSGQQWNSLSTNHPSQARLAIK*

DNA
ATGGGAATTGAAGACATGCATTCAAAATCTGACAGTGGGAACAAGATTGATTCAGAGGTTCATGGTACATTATCGTCGTC
TATAAATAGTTTAAACCCTTGGCATCGTGCTGCTGCTGCCTGCAATGCAAATTCTTGTGTGGAAGCTGGAGATAAATCTT
CTAAGTCAATAGCATTAGCATTGGAATCAAACGGCTCGAAGTCACCATCAAATAGAGAGGATAATGTTAATAAAGAATCA
CAAGTCACAACGTCTCCCCAGTCAGCTGGAAGTGATAAAAATCAAGAATCTCTGCATCCTGGCATCACACAACCTCCTCC
TCACCCTCAACTTGTTGGCCCGACAGTTGGATGGGCATCCTCAAATCCATACCAGGATCCATATTATGCAGGAGTGATGG
GAGCCTATGGACATCATCCCTTGGGTTTTGTTCCATATGGTGGGATGCCTCATTCAAGAATGCAACTGCCTCCTGAGATG
GCACAAGAACCAGTTTTTGTGAATGCTAAACAGTACCAGGCGATTCTGAGGCGAAGGCAGGCACGCGCCAAGGCAGAGCT
AGAGAAGAAGCTAATAAAATCCAGAAAGCCTTATCTCCATGAATCTCGGCATCAACATGCTATGAGGAGGCCAAGGGGTA
CTGGAGGACGGTTTGCAAAGAAAACCAACACCGAAGCTTCACCGCGCAAAGCTGAAGAAAAGAGCAATGGTCGTGTTACT
CAGTCCCCGACGTCATCTAATTCTGATCAAGGTGAAGCTTGGAATGTTGAGTACAGAACACCTCAGGGCGATGAGATGCA
GAGCTCAGCTTATAAGAGAAGGGAAGAAGGAGAGTGTTCAGGGCAGCAATGGAACAGCCTTTCCACAAACCATCCTTCTC
AAGCTCGCCTAGCCATTAAATGA