Details for Lyrate rockcress Locus 16053111

Position : sca3 ( 5`- 9617566 .. 9619188 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053111

Protein [Map View]
MAQSCLKIVRINNLRNRVNRRILILRRFTRLLWSRIVACTPGKSRRYLLLSRAVPSPTVSRPSPPPPIPAVDVDVVVVGG
GGEFVRRSSVVYDNDNSHRRSDSDLVSLKISLLGDPEIGKTSFLAKYVGEEKGVEMRELEKGINCTDKTLYMGGARISYS
IWDLEGAERSRDQIPVACKDSVAILFMFDLTSRCTLNSVISWYQQARKSNQTAIPVMVGTKFDEFIQLPIDLQWTIASQA
RTYAKALNATLFFSSASYNINVNKIFKFVTAKLFDLPWTVERNLTIGEPIIDF*

DNA
ATGGCTCAATCGTGTCTTAAAATTGTTCGAATCAACAATCTAAGGAACAGAGTGAATCGTCGGATTTTGATTCTCCGACG
ATTCACACGGTTGTTATGGAGTAGAATCGTTGCTTGTACTCCTGGCAAATCTCGGAGATATCTCTTGCTTTCTCGCGCTG
TTCCGTCTCCGACTGTTTCTCGTCCTTCTCCTCCTCCTCCAATCCCCGCCGTGGATGTCGATGTCGTCGTCGTCGGTGGT
GGTGGTGAGTTCGTTCGTCGTTCATCGGTTGTCTACGACAACGATAACAGTCATCGGAGATCGGATTCTGATTTGGTTTC
TTTGAAGATCAGCCTCTTAGGAGATCCAGAAATCGGAAAAACTAGCTTCCTGGCGAAATATGTTGGAGAAGAGAAAGGAG
TGGAAATGAGAGAATTGGAGAAAGGGATAAATTGTACGGACAAGACGTTATACATGGGAGGTGCTCGCATTTCATATAGT
ATCTGGGACTTAGAAGGAGCTGAGAGATCACGAGATCAAATCCCTGTGGCTTGCAAGGACTCTGTTGCTATTCTCTTTAT
GTTTGATCTTACCAGTCGTTGCACGCTTAATAGTGTCATTAGCTGGTATCAACAAGCTAGGAAGTCTAATCAGACGGCAA
TACCAGTTATGGTAGGAACCAAGTTTGATGAGTTTATTCAGCTTCCTATTGATCTGCAATGGACAATTGCTAGCCAGGCG
AGAACATATGCGAAGGCTTTAAACGCGACACTCTTCTTCTCGAGTGCTTCATACAACATAAACGTGAATAAGATCTTCAA
GTTTGTGACGGCGAAGCTCTTCGACTTACCTTGGACAGTGGAGCGTAATCTCACAATTGGAGAACCAATCATCGACTTCT
AG