Details for Lyrate rockcress Locus 16053078

Position : sca3 ( 5`- 8081267 .. 8082169 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053078

Protein [Map View]
MARNEEKAQSMLNRFITQKEAEKKKPKERRPFLASECRDLSEADKWRQQILREIGSKVAEIQNEGLGEHRLRDLNDEINK
LLRERYHWERRIVELGGPNYSKHSAKMTDLEGNIIDVPNPSGRGPGYRYFGAAKKLPGVRELFEKPPELRKRKTRYDIYK
RIDASYYGYRDDEDGILEKLERNAEGVMRKRSVEEWRRLDEVRKEARKGASEVVSVGAAAAAAREVLFEEEEDVVEEERM
EREREEEKEREFVVHVPLPDEKEIEKMVLEKKKMDLLSKYASEDLVEQQTEAKSMLNIHR*

DNA
ATGGCGCGTAATGAAGAGAAAGCACAGTCGATGCTCAACAGGTTCATCACCCAGAAAGAAGCTGAGAAGAAGAAGCCGAA
AGAGCGTCGACCTTTCCTTGCATCGGAATGTCGAGATCTATCGGAAGCAGACAAATGGAGACAACAAATTCTGAGAGAGA
TCGGAAGCAAAGTGGCTGAGATTCAGAACGAAGGATTAGGAGAGCACCGACTTCGAGATCTGAACGACGAGATTAACAAG
CTCCTCAGGGAGAGATATCATTGGGAGAGGCGAATCGTTGAGCTAGGTGGTCCGAATTATTCTAAACACTCTGCGAAAAT
GACGGATCTTGAAGGTAACATCATCGATGTACCTAACCCTAGTGGTCGTGGTCCTGGTTATCGTTATTTCGGAGCTGCTA
AGAAGCTTCCTGGAGTTAGAGAGCTTTTTGAGAAGCCTCCTGAGCTAAGGAAGCGTAAGACGAGGTATGATATATACAAA
AGGATAGATGCTAGCTATTACGGGTATAGAGATGATGAGGATGGTATTTTGGAGAAATTGGAGAGGAATGCTGAAGGAGT
GATGAGGAAAAGATCGGTGGAGGAGTGGCGGAGGTTGGATGAGGTTAGGAAGGAAGCTAGGAAAGGTGCTAGTGAGGTTG
TGAGTGTTGGAGCTGCTGCTGCTGCGGCGAGGGAGGTGTTGTTTGAGGAGGAAGAAGATGTGGTTGAGGAGGAGAGGATG
GAGAGGGAGAGAGAGGAGGAGAAAGAGAGGGAATTTGTGGTTCATGTTCCGTTGCCTGATGAGAAGGAGATAGAGAAGAT
GGTATTGGAGAAGAAGAAGATGGATTTGCTTAGTAAGTATGCTAGTGAAGATTTGGTTGAGCAGCAGACTGAGGCTAAAT
CCATGCTCAATATTCATAGATAG