Details for Lyrate rockcress Locus 16053074

Position : sca3 ( 5`- 6346542 .. 6350438 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478950 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16053074

Protein [Map View]
MEDVNQLFDAAFEFAHYPGAQNEASVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERLFKTKYGASLIPQYMPVLQ
VGLKADSAIVKSLACKTVLCLLENCDTNDVSPVQLVVSNCIYPLLLDYIINSDDEVAHAASETIKSLARFPDAMSVIFPS
ETNDATHLRNLAARCSSLARVRVLSLIVKLFSISRLVASEIKKSGLLDLLEAEMKGTKDTLVILNVLELYYELMEVEHSS
EFVPQTSLIQLLCSIISGTSTGPYEKLRAMMISGRLLSKENIYKVVEEASVKALISATDGSLESVEMNDTDAQEAAIDAI
GQIGSTTKGADLVLSTSLPAARHVVASAFDRNAHGKQLAALHALANIAGETRPKSNRIVDGKAEESLRCLIYDVAAQSTK
LTPSGLFLSVLQQSSEIRLAGYRTLTALVARPWCLVEILSKEEIINIVTDATTETAKIAMEARYNCCKAIHEAFLCSNFV
DDPRRQKTGEKLQEAVRSGPYMSKKHRGARPEVMTGEGF*

DNA
ATGGAAGACGTTAACCAGTTGTTCGATGCTGCTTTCGAGTTCGCACACTATCCCGGCGCTCAAAACGAAGCCTCGGTCAA
GGAATTTCTAGATCGCTTTCCTCTTCCCGTTATCTTCAATGCTTTGCAAACCGATCCGGATATACCAGGCTTTGAAAACA
CGCTGGTGACTTGCTTAGAGAGGCTGTTTAAGACTAAGTATGGTGCCTCACTTATTCCTCAGTATATGCCCGTTCTGCAA
GTTGGTCTCAAGGCAGATTCTGCAATAGTTAAATCTCTGGCTTGCAAAACTGTCCTTTGTCTCTTGGAGAATTGCGATAC
AAATGATGTTTCTCCTGTTCAGCTAGTTGTTAGCAATTGCATATACCCTCTTCTGCTTGATTATATCATTAACAGCGATG
ATGAAGTGGCACATGCTGCAAGTGAGACAATTAAGAGTCTAGCACGCTTCCCTGATGCAATGTCTGTAATTTTCCCTTCT
GAAACCAACGATGCTACACATCTTCGTAACCTTGCTGCAAGGTGTTCGTCACTGGCACGAGTCCGGGTTTTGTCTTTGAT
AGTGAAGCTTTTTTCGATTTCTCGACTTGTAGCTTCAGAAATTAAGAAATCAGGGCTTCTTGATTTACTGGAGGCAGAAA
TGAAGGGTACAAAAGACACTCTTGTGATCTTAAATGTTCTGGAACTCTACTATGAGTTAATGGAAGTGGAGCACAGTTCG
GAGTTCGTGCCACAAACTTCACTTATTCAGCTGTTGTGTTCTATCATCAGTGGTACATCGACGGGACCCTATGAAAAGTT
AAGAGCAATGATGATTAGTGGCAGGCTACTCTCAAAGGAAAATATCTACAAAGTCGTGGAAGAAGCTAGTGTGAAGGCGT
TAATTTCAGCTACTGATGGGAGTCTGGAGTCGGTGGAGATGAATGATACTGATGCACAGGAAGCTGCCATTGATGCAATT
GGTCAGATTGGATCAACAACAAAGGGAGCGGATCTGGTGCTTTCAACTTCACTTCCAGCTGCAAGACATGTTGTAGCTTC
TGCCTTTGATCGTAATGCACATGGAAAACAGTTGGCTGCACTGCACGCACTGGCAAACATCGCAGGTGAAACACGACCTA
AGAGCAACAGAATAGTTGATGGAAAAGCTGAAGAAAGCCTTAGATGTCTGATATACGATGTTGCAGCACAGAGCACAAAA
CTAACCCCATCTGGTTTATTCCTCTCAGTTCTTCAACAAAGCTCAGAGATTCGTCTTGCGGGTTATAGAACGTTAACAGC
ATTGGTGGCTCGGCCATGGTGCCTGGTGGAAATCTTGTCCAAAGAAGAGATAATAAACATAGTTACGGATGCAACCACTG
AAACTGCAAAAATAGCAATGGAAGCAAGGTATAACTGCTGCAAAGCAATTCACGAAGCGTTCTTATGTAGTAACTTTGTT
GATGACCCTCGTCGTCAAAAAACGGGTGAAAAGTTGCAAGAAGCTGTTCGAAGTGGACCATATATGTCGAAGAAGCACAG
AGGTGCACGACCAGAAGTAATGACAGGCGAAGGATTTTAA