Details for Lyrate rockcress Locus 16053071

Position : sca3 ( 5`- 4101145 .. 4102714 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897206 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16053071

Protein [Map View]
MSGYPPSSQGYGYGGNPPPPQPPYGSSGNNPPPYGSSGNNPPPYGSSASSPYAVPYGAQPAPYGAPPSAPYASPPGDHTK
PHKEKPHGGAYGSPSPGGYGGYGGHGGGYGAPPPQQASYGSPFASLVPSAFPPGTDPSIVACFQAADRDNSGFIDDKELQ
GALSSYNQSFSIRTVHLLMYLFTNSNVRKIGPKEFTSLFFSLQNWRSIFERFDKDRSGRIDTNELRDALMSLGFSVSPVI
LDLLVSKFDKSGGRNRAIEYDNFIECCLTVKGLTEKFKEKDTVLSGSATFNYENFMLTVLPFLVA*

DNA
ATGTCTGGTTATCCTCCATCGAGCCAAGGTTACGGTTACGGCGGTAATCCACCACCGCCTCAGCCACCGTACGGATCATC
CGGCAACAATCCTCCTCCCTACGGATCATCCGGCAATAATCCTCCTCCGTACGGATCATCAGCCTCCTCACCGTACGCTG
TTCCCTACGGAGCTCAGCCCGCGCCTTACGGTGCACCACCGTCAGCACCGTACGCGTCTCCTCCAGGAGACCATACTAAG
CCGCACAAAGAAAAACCTCACGGCGGCGCTTACGGATCTCCATCTCCCGGTGGTTACGGTGGTTACGGAGGACATGGAGG
AGGTTACGGGGCTCCTCCTCCTCAGCAAGCTTCTTATGGAAGTCCGTTTGCGTCTCTGGTTCCGTCGGCGTTTCCTCCCG
GAACAGATCCGAGCATCGTGGCTTGTTTCCAAGCTGCGGATCGGGACAATAGTGGATTCATCGATGATAAGGAGCTTCAG
GGAGCTCTCTCTTCCTATAATCAGAGCTTCAGCATAAGAACTGTTCATCTTCTTATGTATCTCTTCACCAACAGCAATGT
CAGGAAGATTGGACCAAAAGAGTTTACTTCTCTTTTCTTTAGTCTTCAGAATTGGAGGTCTATCTTTGAGAGGTTTGATA
AGGACAGAAGTGGTAGAATAGATACAAACGAGCTGAGAGATGCACTCATGAGCCTTGGGTTTTCAGTGTCTCCTGTGATT
TTGGATCTGCTGGTTTCCAAGTTTGACAAAAGCGGAGGCAGGAACAGGGCTATTGAATATGACAATTTCATCGAGTGTTG
TTTGACTGTAAAGGGGCTGACCGAGAAGTTTAAGGAGAAGGATACGGTGTTATCAGGCTCAGCTACTTTCAATTACGAGA
ACTTCATGCTCACTGTTTTACCATTCCTTGTCGCTTGA