Details for Lyrate rockcress Locus 16053067

Position : sca3 ( 5`- 8555833 .. 8560280 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16053067

Protein [Map View]
MKTPTLLLLFLSFLSVILPSSSGQGEWEILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKNEIAQMVQSREEFGLLKLT
VVYRNSEKVLAQAIGAANGITILYYHNSVPYNYLGKLRGSNILSSIHPYLTSTPEELPLKHLKSPKSLKDFLESSDKALL
LFEFCGWTTTLLSELKKNVTEDNLWQEWNNMCGLQSGFGKVPWLEDFSYANDTAALQEHGRVNLGFGQTCNHEDFKQFSS
FLSKLIATTKEFSLPPERQKFGLITEESLASSFNIGKSDSWAAVLQLAGCPHCSKIFKAGDDIQRFLKMENPVVTELEDD
WQDHESSLPASKPSVILFVDRSSGSLEERRRSMKALDTFREVAAQHKLSDIKQWENDIKYEKSVSQADKKSGSVSLPKTV
QKFKKIKLENKVSFMILDGDKHVALDTAAPGMEGSSLQEILTNLFHRRKESKLSSLAKDVGFRLLSDDVHIKVLDALPSQ
AEVVSSQDTTSSSAEGSSEISLHPKDAEVQNRVSMSSEEKDEMKSSETESSSPSDEEQVTTNRSEQLVMAETDKTEVYLK
KNINGEIKVSLHSEPKEDLVHKFTGSFFFSDANYVLLRALTGDVKIPSAVIIDPALQQHYVLQDKFSYSSLVDFLDGYLN
GSLSPYTQSESSIQTPKKATVPPFVNLDFHEVDSIPRVTVSTFSHMVHAWDQSSAEKAPCPLCQDVLVLFSNNWCGFCQR
MELVLHEVYRSLKEYKAIIQGGSTNNQRFKSAERNKVTPYEGETSVTDITEFLARHANNSRGFFRLLPTLSRNGRRNSNK
LDQSSSAVDYKVTDGDKLVEVVLRNREPAEREVNHYQVNSESPPTHSLTTAPQVKTGTILVATEKLAASQPFAKSKILII
KAGPEFGFLGLIFNKRIRWKSFPDLGETAELLEETPLLFGGPVVDPGIPLLALTREKDSSTDHDHPEISPGVYFLDHQSV
ARRIQELKSRELNPSEYWFFLGYSSWSYEQLFDEIGLGVWDVDNSDIDFAWP*

DNA
ATGAAGACGCCGACGCTCCTCCTTCTCTTCCTATCCTTCTTATCCGTTATTCTTCCATCGTCAAGTGGGCAAGGCGAATG
GGAGATCCTAACGGAGCAAAACTTCTCTTCTCAGATCCGTCTCCACCCTCATGTCCTCCTCTTTGTCACCACTCCATGGT
GTGGTGAGTCCAGATCTCTTAAGAATGAAATTGCTCAGATGGTTCAAAGTAGGGAGGAATTTGGCTTGTTGAAGTTAACG
GTTGTATACAGAAACTCAGAAAAGGTGTTAGCACAAGCCATTGGTGCTGCCAATGGAATAACAATTTTGTACTATCACAA
TAGTGTGCCTTACAACTATCTAGGGAAACTCCGAGGTTCAAATATATTGTCCTCTATTCATCCTTATCTGACATCTACTC
CTGAAGAACTCCCTCTCAAACATTTGAAGTCTCCAAAGAGTTTGAAAGATTTTCTTGAATCATCTGACAAGGCTTTACTT
CTGTTCGAATTTTGCGGATGGACTACTACGCTGCTATCTGAGCTGAAGAAAAATGTTACTGAAGATAACCTTTGGCAGGA
ATGGAACAATATGTGTGGACTCCAAAGTGGATTTGGTAAAGTTCCTTGGCTTGAGGATTTTAGCTATGCCAATGATACTG
CTGCTTTGCAGGAACATGGCAGGGTAAATCTGGGGTTTGGACAGACATGTAACCATGAAGATTTCAAGCAATTTAGTTCA
TTCCTCTCTAAACTGATTGCCACCACAAAAGAGTTTTCTCTGCCTCCTGAAAGGCAAAAATTTGGTCTGATTACAGAAGA
ATCATTGGCTTCATCATTTAATATTGGAAAATCTGATTCGTGGGCAGCGGTCCTTCAGCTGGCAGGATGTCCACATTGTT
CAAAGATTTTCAAGGCCGGGGACGACATTCAGAGATTTTTAAAGATGGAGAATCCGGTAGTCACAGAGCTGGAGGACGAC
TGGCAGGACCATGAGTCATCTTTACCTGCAAGTAAACCCTCAGTTATTCTTTTTGTGGATAGATCAAGTGGGTCCTTGGA
GGAGAGGAGAAGGAGTATGAAAGCACTTGATACTTTCAGAGAGGTAGCTGCACAGCATAAATTGTCTGACATAAAACAAT
GGGAGAATGATATTAAGTATGAGAAATCCGTTAGCCAGGCTGATAAAAAATCGGGGTCTGTGTCACTTCCAAAAACTGTC
CAAAAGTTTAAGAAAATTAAGTTAGAGAATAAGGTCTCTTTTATGATTTTGGATGGGGATAAACATGTAGCCCTAGATAC
TGCAGCGCCAGGTATGGAAGGCAGTTCCCTGCAGGAGATACTGACAAATCTTTTTCACAGAAGAAAAGAAAGTAAATTGA
GCTCGCTTGCTAAGGATGTTGGTTTCCGTCTGTTATCTGATGATGTGCACATAAAAGTGCTGGATGCGTTACCGTCACAA
GCAGAAGTTGTGTCTAGTCAAGATACAACTTCATCTTCTGCAGAAGGTTCCAGTGAAATTTCTCTTCACCCTAAAGATGC
AGAGGTGCAGAACAGAGTCAGTATGAGTTCTGAAGAAAAAGATGAAATGAAATCCTCTGAAACTGAATCCTCCTCCCCTA
GTGATGAAGAGCAGGTTACTACAAATAGGAGTGAACAATTAGTAATGGCAGAAACCGATAAGACTGAGGTTTATTTGAAA
AAAAATATTAATGGAGAGATCAAGGTATCGTTGCACTCAGAACCGAAGGAAGATCTAGTGCATAAATTCACGGGTTCATT
TTTCTTCTCTGATGCAAATTATGTATTACTGAGGGCTCTTACTGGTGATGTAAAGATTCCATCAGCAGTAATTATTGACC
CTGCTTTACAACAGCACTATGTCCTTCAAGATAAGTTCAGCTATTCGTCACTGGTCGACTTTCTTGATGGATATCTCAAT
GGAAGTCTATCTCCTTATACACAGTCTGAATCTAGCATTCAGACGCCTAAAAAAGCTACAGTTCCACCTTTTGTTAATCT
GGATTTTCACGAGGTGGATTCTATTCCCCGTGTCACAGTCAGTACCTTCTCCCATATGGTTCATGCATGGGATCAATCCA
GTGCAGAGAAGGCTCCTTGTCCTCTGTGCCAGGACGTTTTGGTCCTTTTTAGTAATAACTGGTGTGGGTTTTGTCAGAGG
ATGGAGCTAGTTCTGCATGAAGTATACCGTTCACTAAAAGAATATAAAGCGATTATACAAGGAGGATCTACGAACAATCA
AAGGTTCAAATCAGCCGAGAGAAACAAAGTCACTCCATATGAAGGGGAGACATCTGTAACTGACATAACAGAGTTTCTAG
CACGCCATGCAAATAACTCTCGTGGGTTTTTCAGACTCCTTCCTACTCTGTCTAGAAATGGAAGAAGAAACTCAAACAAG
TTGGATCAATCTTCATCTGCGGTAGACTATAAAGTGACAGATGGTGATAAACTTGTTGAGGTCGTTTTAAGGAACAGAGA
GCCCGCTGAAAGAGAGGTAAACCATTACCAGGTCAATTCCGAATCGCCTCCAACACACTCGCTCACAACCGCTCCCCAAG
TGAAAACCGGCACAATCCTGGTCGCTACAGAAAAACTAGCTGCCTCCCAACCATTTGCCAAATCAAAGATTCTGATCATA
AAAGCAGGCCCTGAATTCGGTTTCCTGGGTCTAATCTTCAACAAACGGATAAGGTGGAAATCGTTCCCTGACCTAGGGGA
AACAGCCGAGCTCTTGGAAGAGACTCCTCTATTGTTCGGAGGTCCCGTCGTGGATCCAGGAATACCACTTTTAGCTCTGA
CCCGAGAGAAAGACTCATCCACGGACCATGATCACCCGGAAATCTCACCAGGCGTTTATTTCTTAGATCATCAATCAGTG
GCCCGTCGAATCCAAGAGTTGAAATCTAGAGAGCTAAATCCAAGTGAGTACTGGTTTTTCTTGGGATACTCAAGCTGGAG
TTATGAGCAGTTGTTTGATGAGATAGGTCTTGGAGTATGGGATGTTGATAACAGTGACATTGACTTTGCTTGGCCTTGA