Details for Lyrate rockcress Locus 16053058

Position : sca3 ( 5`- 7979386 .. 7978245 -3` )
Annotation : [B2G] single-strand-binding family protein
External links : CoGe
PGDD synteny : 16053058

Protein [Map View]
MANSVATLSRRLYRSLLSNPRISQSSMSFCTNNISSREDSDFDELSANSDTESPIEPKASDPVSRFSGEERVMEERPLEN
GLDSGIFKAILVGQVGQLPLQKKLKSGRTVTLFSVGTGGIRNNRRPLINEDPREYASRSAVQWHRVSVYPERLAELVLKN
VEPGTVIYLEGNLETKIFTDPVTGLVRRIREVAIRRNGRVVFLGKAGDMQQPSSAELRGVGYY*

DNA
ATGGCGAATTCAGTGGCTACGCTTTCGAGAAGACTCTATCGATCTCTTCTCTCGAACCCTAGAATTTCTCAATCTTCCAT
GTCTTTCTGCACCAACAACATCTCCTCCCGAGAAGACTCCGACTTTGACGAGTTATCTGCTAACTCAGATACTGAATCCC
CCATTGAACCCAAGGCTTCGGATCCAGTTTCTCGATTTTCCGGAGAAGAACGCGTGATGGAAGAGCGTCCACTCGAAAAT
GGCCTTGACTCTGGCATTTTCAAGGCGATATTGGTGGGGCAAGTGGGTCAGCTACCTCTGCAGAAGAAGCTTAAGAGTGG
TAGAACAGTCACTCTCTTCTCTGTAGGAACCGGTGGGATCAGGAACAACCGGAGACCGCTTATTAACGAAGATCCGAGAG
AGTATGCGAGTCGGTCTGCTGTGCAGTGGCACCGTGTCTCTGTTTACCCTGAACGCTTGGCAGAGCTTGTGTTGAAGAAT
GTTGAACCCGGTACAGTTATCTACTTGGAGGGTAATCTGGAGACGAAGATTTTCACTGATCCAGTCACTGGTTTGGTTCG
ACGTATAAGAGAAGTAGCAATTCGTAGAAACGGCCGAGTTGTGTTTTTGGGAAAAGCCGGTGATATGCAGCAACCAAGTT
CTGCTGAGCTTAGAGGCGTTGGCTACTACTGA