Details for Lyrate rockcress Locus 16053050

Position : sca3 ( 5`- 498105 .. 497766 -3` )
Annotation : [B2G] 60s ribosomal protein l39
External links : CoGe
PGDD synteny : 16053050

Protein [Map View]
MPSHKSFMIKKKLGKKMRQNRPIPNWIRLRTDNRIRYNAKRRHWRRTKLGF*

DNA
ATGCCGTCGCACAAGTCGTTCATGATTAAGAAGAAGCTAGGGAAGAAGATGAGACAGAACAGGCCGATCCCTAATTGGAT
CCGTCTTCGTACCGATAACAGAATCAGGTACAACGCTAAGCGTAGGCACTGGCGCCGTACCAAGCTAGGGTTCTAG