Details for Lyrate rockcress Locus 16053043

Position : sca3 ( 5`- 22284829 .. 22280005 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480680 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16053043

Protein [Map View]
MNIENIPDSPMVSRKIRKVFDKMTQWVTPWRSNLESPREMMILRGDVEQDEFQYASSHCLSSYYSVFVVRLAIMVMLAIL
IGLLTVLTWHFTRIYTKQSLKTLAYGLRYELLQRPVLRMWSVLNTTSELTTAQVKLSEYVIKKYDKPTTQEELVEMYQAM
KDVTWALFASAKALNAITINYRNGFVQAFHRDPASSSTFYIFSDLKNYSISGIGPEDVSGWNNQSIHGNMTAIWYQQQLD
PVTGEKLGKPLKIPPDDLINIAGILQVPDGEASWHVTVSKYMDSPLLSAALPVFDASNKSIVDVVGVTTALYSVGQLMRD
LVDVHGGHIYLTSQEGYLLATSTNGPLLKNTTNGPKLMKAIDSEEWVIRAGAQWLEKTYGSKRPQEVHAENVKLGNQRYY
IDSFYLNLKRLPIIGVVIIPRKFIMGKVDERAFKTLIILISASVCIFFIGCVCILILTNGVSKEMKLRAELIRQLDARRR
AEASSNYKSQFLANMSHELRTPMAAVIGLLDILISDDCLSNEQYATVTQIRKCSTALLRLLNNILDLSKVESGKLVLEEA
EFDLGRELEGLVDMFSVQCINHNVETVLDLSDDMPALVRGDSARLVQIFANLISNSIKFTTTGHIILRGWCENINSLHDE
MRLTVDRKKPWAPMKTKLVQHRNHLQKSCKNANKMVLWFEVDDTGCGIESSKWDSVFESFEQADPSTTRTHGGTGLGLCI
VRNLVNKMGGEIKVVQKNGLGTLMRLYLILSTPETADQNIQPDFSKYGLVVLLSMYGSTARMITSKWLRKHGIATVEASD
WNELTQIIRDLLEMGSRDNSFDSQNNIADSLRAELSNIEEIKNPVFVVVVDIGVLDLTTDIWKEQLNYLDRFSNKAKFAW
LLKHDTSNIVKTELRRKGHVMMVNKPLYKAKMIQILEAVIKNRKRCNGLRNRGNGSDESHDFLEIDPTQFDTCSSDDSSE
TSGEKHIDKSVQPSTLHSPVLKNYLIDANNSNDDSTSASTTQKNLEEEDWKDRLYSGIALDGKNQKSLEGIRILLAEDTP
VLQRVATIMLEKMGATVTAVWDGQQAVDSLNYRSINVQDPTGEPTSSEEETANNSINPQSSLRNSSPYDLILMDCQMPKM
DGYDATKAIRRAEIGTELHIPIVALTAHAMSSDEAKCLEVGMDAYLTKPIDRKLMVSTILSLTKPSIFQTSLSA*

DNA
ATGAATATTGAGAATATTCCTGATTCTCCAATGGTTTCGAGGAAGATCAGGAAGGTGTTCGATAAAATGACTCAATGGGT
TACCCCTTGGAGAAGTAATTTGGAGAGTCCAAGAGAGATGATGATTTTGCGTGGAGATGTTGAACAAGATGAGTTTCAAT
ACGCAAGTAGTCACTGTTTGTCTTCTTACTACAGTGTCTTTGTTGTTCGCCTCGCTATAATGGTGATGTTAGCAATTCTG
ATAGGGCTTTTAACCGTTCTAACATGGCATTTCACAAGGATTTACACGAAGCAGTCACTTAAAACATTAGCATATGGCCT
TCGATACGAGCTTCTTCAGCGTCCGGTCTTACGGATGTGGAGCGTTTTAAACACCACATCCGAGCTAACAACAGCTCAAG
TCAAGTTATCTGAATATGTCATCAAAAAATATGACAAGCCAACAACTCAAGAAGAGCTCGTCGAGATGTATCAAGCAATG
AAGGATGTGACATGGGCTCTGTTTGCTAGTGCCAAAGCTCTAAATGCCATAACTATAAACTACAGAAATGGATTTGTCCA
AGCTTTTCACAGAGATCCAGCAAGTAGCAGCACATTCTACATCTTCTCCGATCTAAAAAACTATTCCATCAGTGGAATAG
GGCCTGAAGATGTAAGCGGGTGGAACAACCAGTCAATACACGGGAACATGACTGCCATTTGGTACCAGCAACAGCTTGAT
CCAGTAACAGGGGAAAAATTGGGAAAGCCTCTTAAAATTCCACCCGATGATCTGATCAACATCGCAGGAATCTTACAAGT
GCCAGATGGTGAAGCTTCTTGGCATGTGACAGTGAGCAAATACATGGACTCTCCGCTTCTCTCAGCGGCTTTGCCTGTCT
TTGATGCATCAAACAAGAGTATCGTGGATGTTGTGGGGGTGACAACTGCACTTTACAGCGTAGGGCAGTTGATGAGAGAT
CTTGTAGATGTCCATGGTGGACATATCTATTTGACATCTCAGGAAGGATACTTGCTTGCTACTTCCACAAATGGTCCTCT
TTTAAAAAATACAACAAACGGGCCAAAGCTAATGAAAGCCATTGATTCAGAGGAGTGGGTTATAAGGGCAGGAGCCCAGT
GGTTAGAGAAAACTTATGGAAGTAAACGCCCTCAAGAAGTTCATGCTGAGAATGTAAAGCTTGGTAACCAACGATATTAC
ATTGATTCATTCTATCTTAATCTCAAGAGACTTCCAATTATAGGTGTTGTCATTATTCCCAGGAAGTTCATTATGGGAAA
AGTGGATGAAAGGGCCTTCAAGACTTTGATTATACTGATTTCTGCTTCTGTCTGCATCTTCTTTATTGGATGTGTCTGCA
TTTTGATTCTCACAAATGGAGTTTCAAAGGAGATGAAACTAAGAGCAGAACTGATAAGGCAACTGGATGCAAGAAGAAGA
GCTGAAGCTTCAAGCAACTACAAAAGCCAGTTTTTGGCAAATATGAGCCATGAGTTGAGGACACCTATGGCTGCTGTGAT
TGGATTACTAGATATTCTTATATCAGATGATTGTCTTTCAAATGAGCAATACGCAACAGTCACTCAGATCAGAAAGTGCT
CTACCGCTCTCCTCCGGCTTCTCAATAACATACTGGACTTGAGCAAGGTTGAGTCAGGAAAGCTTGTTCTGGAAGAAGCT
GAGTTCGATTTGGGGCGAGAACTTGAAGGACTTGTTGACATGTTCTCAGTGCAGTGTATTAACCACAATGTAGAGACAGT
TCTAGACCTCTCTGATGATATGCCAGCGTTAGTCAGAGGAGACTCGGCAAGACTTGTTCAAATATTTGCAAATCTTATAA
GCAATTCTATAAAGTTTACAACAACGGGTCACATAATTCTTCGTGGATGGTGCGAGAACATAAATTCTCTACATGATGAG
ATGAGATTAACTGTTGACAGGAAGAAACCATGGGCTCCAATGAAGACAAAACTGGTGCAACACAGAAATCATTTGCAGAA
GTCTTGTAAGAACGCGAACAAAATGGTTCTTTGGTTTGAGGTTGATGACACTGGATGTGGAATAGAATCAAGCAAATGGG
ACTCGGTTTTTGAGAGCTTTGAGCAAGCTGATCCTTCTACCACTCGGACGCACGGAGGAACTGGTCTTGGACTATGTATC
GTGCGAAACTTGGTTAACAAAATGGGTGGAGAAATTAAAGTAGTGCAGAAGAATGGCTTAGGGACTCTAATGAGACTGTA
CTTGATTTTGAGTACTCCTGAAACTGCAGATCAAAATATCCAGCCAGATTTCTCCAAATATGGTCTCGTGGTTTTGCTTT
CCATGTATGGAAGTACAGCAAGAATGATCACATCGAAGTGGTTGCGTAAACACGGCATTGCAACTGTTGAAGCATCGGAC
TGGAACGAGCTGACTCAGATCATTAGAGACCTTTTGGAGATGGGAAGCCGTGACAACAGCTTTGATTCACAGAACAATAT
TGCTGATTCACTGAGAGCAGAGCTTTCAAATATAGAAGAAATCAAGAACCCTGTGTTTGTCGTAGTGGTGGATATCGGAG
TACTTGATCTCACCACAGATATATGGAAGGAACAGCTTAACTACCTCGACAGATTCTCCAACAAAGCAAAGTTTGCTTGG
CTGCTGAAGCATGACACCTCCAATATAGTCAAAACAGAACTTAGACGAAAAGGGCATGTCATGATGGTTAACAAACCGTT
GTACAAGGCCAAAATGATTCAGATTCTGGAAGCTGTAATAAAAAACCGGAAGAGATGTAATGGCTTAAGAAACAGAGGAA
ACGGAAGTGATGAATCCCACGATTTCTTAGAAATCGATCCAACACAATTCGACACTTGCAGTTCCGATGATTCCTCTGAG
ACATCTGGCGAGAAACATATAGATAAATCTGTGCAACCAAGCACCTTGCACTCTCCAGTTCTTAAGAACTATCTCATTGA
CGCCAATAACAGCAATGATGACTCAACATCTGCAAGTACGACTCAAAAGAACCTAGAAGAAGAAGATTGGAAAGATCGGC
TGTATTCAGGAATTGCATTGGATGGAAAGAATCAGAAATCTCTTGAAGGTATTAGGATCTTGCTGGCAGAGGATACACCC
GTTCTTCAACGAGTAGCCACCATAATGCTTGAGAAAATGGGAGCAACTGTAACTGCAGTCTGGGATGGACAACAAGCAGT
TGATTCCCTCAACTACAGGTCTATAAATGTTCAAGATCCAACTGGAGAACCGACATCGTCAGAAGAAGAAACCGCCAACA
ACTCTATAAATCCGCAGAGTAGTTTACGGAATTCCTCACCTTATGACTTGATCCTCATGGATTGCCAGATGCCAAAAATG
GATGGATATGACGCAACGAAGGCGATAAGGAGAGCAGAGATTGGCACTGAGCTGCACATTCCAATCGTGGCATTGACAGC
GCATGCAATGTCTTCTGACGAAGCGAAATGCTTGGAGGTTGGAATGGATGCTTATCTGACAAAGCCTATAGATCGAAAGC
TTATGGTCTCTACCATTTTGTCACTCACTAAACCATCAATATTCCAAACTTCATTGTCTGCTTGA