Details for Lyrate rockcress Locus 16053041

Position : sca3 ( 5`- 12839485 .. 12842946 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480041 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16053041

Protein [Map View]
MGWLVEAIVASILLSLCFAITESAPKSALITELPGFNGTFPSKHYAGYVAIDKHRNKNLWYYFVESERNASVDPVVLWLN
GGPGCSSMDGFVYEHGPFNFEPKKRNSHLLHLNPYSWSKVSNIIYLDSPVGVGFSYSNDNADYTTNDTKTAFDSHRFLLE
WFKMFPEFRSNPFFISGESYAGIYVPTLAAQVVKGHKNVTTKPLINFKGYLVGNGVTDEVFDGNALVPFTHGMGLISDEL
YEETKLVCNGTYYTGGHSGVSKECADKLKKVSDTVSLLNLYNILEPCYHGTSLSALDIEFLPKSLLTLGKTEKPMAVRKR
MFGRAWPLGAVVRPGIVPSWSQLLEGSGVPCIDDTVATKWLNDPAVRKAVHAKEVSTLSTHFIIFFLISLSIGNWKLCSS
QLEYRHDTGSMIEYHRNLTLSGFRALVFSGDHDMCVPYTGSEAWTKAMGYKVVDEWRPWISNNQAAGFTQGYANNLTFLT
IKGAGHTVPEYKPRESLDFYSRFLAGEKI*

DNA
ATGGGTTGGTTAGTGGAAGCTATCGTTGCTTCGATATTGTTGTCTTTGTGTTTTGCAATAACAGAGTCAGCTCCAAAATC
TGCTCTCATTACCGAACTTCCTGGTTTCAACGGAACGTTTCCATCTAAACACTATGCCGGGTATGTGGCAATAGATAAAC
ATCGTAACAAGAATTTATGGTATTACTTTGTGGAGTCTGAGAGAAATGCTTCAGTAGATCCAGTTGTGCTTTGGCTTAAT
GGTGGTCCAGGTTGCTCTAGCATGGATGGATTTGTCTACGAGCACGGTCCATTCAATTTCGAACCAAAAAAGAGAAACTC
ACATCTTCTGCATCTCAATCCTTATAGTTGGTCCAAGGTGTCCAACATCATATACCTTGACTCTCCAGTTGGTGTGGGAT
TCTCTTACTCAAACGACAACGCCGATTATACAACTAATGATACGAAAACCGCGTTTGATTCTCACAGATTCCTTCTTGAG
TGGTTTAAAATGTTTCCGGAGTTTCGGTCAAATCCGTTCTTTATATCAGGAGAATCATATGCTGGTATCTATGTGCCAAC
TCTTGCGGCCCAGGTTGTCAAAGGTCATAAGAATGTGACGACAAAGCCGCTTATCAACTTCAAGGGATACTTGGTGGGTA
ATGGAGTTACTGATGAGGTGTTTGATGGTAATGCTCTTGTTCCCTTCACACATGGGATGGGACTCATCTCTGATGAACTC
TATGAGGAAACTAAATTAGTGTGCAATGGAACATACTATACCGGCGGCCACTCAGGTGTAAGTAAAGAATGTGCTGACAA
GCTTAAAAAAGTGTCAGATACTGTGAGCTTATTGAACTTATATAACATTCTAGAACCGTGCTACCACGGAACATCTCTAT
CCGCCCTAGATATTGAGTTTCTGCCTAAGAGTCTCCTTACTCTAGGCAAAACAGAAAAGCCAATGGCAGTGAGAAAGAGA
ATGTTTGGTCGTGCATGGCCTCTAGGGGCCGTTGTGCGTCCAGGCATTGTACCTAGTTGGTCTCAACTCCTCGAGGGCTC
TGGTGTTCCTTGCATTGACGATACAGTTGCGACCAAATGGCTAAACGATCCAGCTGTACGGAAAGCGGTTCATGCTAAAG
AGGTCTCTACTCTCTCTACCCATTTCATCATATTTTTCTTAATAAGCCTTTCGATTGGAAATTGGAAGTTATGCTCAAGC
CAACTCGAATATAGGCACGACACTGGTAGCATGATCGAATACCATAGAAACCTCACTCTTAGTGGCTTTCGAGCTCTCGT
TTTCAGCGGAGATCACGATATGTGTGTACCATATACTGGTTCTGAAGCATGGACTAAGGCAATGGGATACAAAGTGGTTG
ATGAGTGGAGACCATGGATTTCAAATAACCAAGCCGCCGGGTTTACACAAGGGTATGCCAATAATCTCACATTTCTAACC
ATTAAGGGTGCAGGACATACCGTTCCAGAATACAAACCACGTGAATCTTTGGACTTCTATAGTCGTTTTCTAGCAGGAGA
AAAGATATAG