Details for Lyrate rockcress Locus 16053024

Position : sca3 ( 5`- 11844810 .. 11845256 -3` )
Annotation : [B2G] atmbf1c mbf1c
External links : CoGe
PGDD synteny : 16053024

Protein [Map View]
MPSRYPGAVTQDWEPVILHKSKQKSQDLRDPKAVNAALRNGVAVQTVKKFDAGSNKKGKSTAVPVINTKKLEEETEPAAM
DRVKAEVRLMIQKARLEKKMSQADLAKQINERTQVVQEYENGKAVPNQAVLAKMEKVLGVKLRGKIGK*

DNA
ATGCCGAGCAGATACCCAGGAGCAGTAACACAAGACTGGGAACCAGTAATTCTCCACAAATCAAAACAAAAGAGTCAAGA
CCTACGCGATCCAAAAGCGGTTAACGCAGCGCTTAGAAACGGCGTCGCGGTTCAAACGGTTAAGAAATTCGACGCCGGTT
CTAACAAAAAGGGGAAATCTACGGCGGTTCCGGTGATTAACACGAAGAAACTTGAGGAAGAAACAGAGCCTGCGGCGATG
GATCGTGTGAAAGCAGAGGTGAGGTTGATGATACAGAAGGCGAGGTTGGAGAAGAAGATGTCGCAAGCAGATTTGGCGAA
ACAGATAAATGAAAGGACTCAGGTGGTTCAGGAATATGAGAATGGTAAAGCTGTTCCTAATCAGGCTGTGCTTGCGAAGA
TGGAGAAGGTTCTAGGTGTTAAACTTAGGGGTAAAATTGGTAAATGA