Details for Lyrate rockcress Locus 16053001

Position : sca3 ( 5`- 6018845 .. 6018219 -3` )
Annotation : [B2G] integral membrane family protein
External links : CoGe
PGDD synteny : 16053001

Protein [Map View]
MDKTDQTAIDGSALELNRTEKTVEAVLRVASMALSITGLVIMIKNSISNDFGSLSYSNLGAFMYLVGANGVCAAYSLLSA
LAILALPCPISKVQVRTLFLLDQVVTYVVLAAGAVSAETVYLAYYGNIPITWSSACDSYGIFCHKALISVVFTFVVSLLY
MLLSLISSYRLFSRFEAP*

DNA
ATGGACAAGACTGATCAAACAGCTATTGACGGCTCAGCTTTAGAGCTTAACCGCACTGAGAAAACGGTAGAGGCGGTCTT
GCGAGTAGCATCAATGGCTCTAAGTATTACGGGTCTCGTCATCATGATCAAGAACTCTATCTCCAACGACTTTGGCTCTC
TTTCTTACTCAAATCTTGGAGCTTTCATGTATTTGGTGGGTGCTAATGGCGTTTGTGCTGCCTATTCTCTTCTTTCTGCT
CTCGCAATATTAGCCCTTCCGTGTCCAATAAGCAAGGTCCAAGTCAGGACATTATTCTTGCTAGACCAGGTGGTCACATA
CGTGGTTCTAGCGGCTGGGGCTGTATCTGCAGAGACGGTTTACTTAGCATACTATGGAAACATACCCATCACTTGGAGCT
CTGCTTGTGACTCCTATGGAATCTTCTGTCACAAGGCATTGATCTCGGTTGTGTTCACATTCGTTGTCTCCCTTCTCTAC
ATGTTGCTCTCGCTTATCTCTTCCTATCGACTCTTCAGCAGATTTGAAGCACCCTAA