Details for Lyrate rockcress Locus 16052995

Position : sca5 ( 5`- 17850357 .. 17852038 -3` )
Annotation : [B2G] amino acid transporter family protein
External links : CoGe
PGDD synteny : 16052995

Protein [Map View]
MSPQIKTHLLPKQEPSSSENHGSSTSGIVFNVSTSIIGAGIMSMPAAFKVLGIVPAFLIITIIAWLSTISVGFLMKSTLA
GESTTYAGVMKESFGKTGSVAAQIATMVATFGCMIVFSIIIGDVLSGNENGGSQHLGVLQEWFGSYWWNTRIFALLFIYC
FVLLPLVLCRRVERLAFSSAVSFLLAVLFVVISSVLAISALVNGQTKNPRLNPELSNGGSFWKLFTASPVIVTAFTFHFN
VHPIGFELKDPLQVIPATKLSVILCAAIYFATGLFGYLLFGDATMSDILVNFDQSSGSSIGSLLNDIVRLSYALHLMLVF
PLMNFSLRANLDELLFPKKPSLEKDTKRFIGLTLALLICCFLSAITVPDIWYFFQFLGSTTTVSIAFIFPAAIVLRNIHG
VSTSREKIVAAIMLVLAVATSIIAISTNLYSLAAN*

DNA
ATGTCACCACAGATCAAAACTCATCTCTTGCCTAAGCAAGAACCTTCGTCGTCTGAGAACCATGGATCATCAACCTCCGG
CATCGTTTTCAACGTGTCTACGAGTATAATCGGAGCCGGGATAATGTCGATGCCGGCGGCGTTTAAGGTTCTTGGAATAG
TCCCAGCGTTTTTGATTATCACGATCATAGCTTGGCTTTCCACAATTTCCGTTGGATTTCTAATGAAATCAACACTCGCC
GGAGAATCAACTACTTACGCCGGAGTCATGAAAGAGTCGTTCGGAAAAACAGGATCCGTCGCTGCACAGATTGCTACGAT
GGTTGCTACTTTTGGTTGTATGATTGTCTTTTCGATTATTATAGGAGATGTGCTTTCGGGTAATGAAAATGGAGGATCTC
AACATCTTGGAGTTTTGCAAGAATGGTTTGGTTCTTACTGGTGGAACACGAGAATCTTCGCTTTGTTGTTCATTTACTGC
TTTGTCTTGCTTCCATTGGTCTTGTGTAGACGAGTCGAAAGACTGGCATTTAGTTCTGCGGTATCGTTTCTGCTGGCGGT
TCTATTTGTTGTCATAAGCTCGGTGCTGGCGATTTCCGCGCTGGTGAATGGACAAACGAAGAATCCAAGACTGAATCCGG
AGTTAAGCAATGGAGGATCGTTTTGGAAACTTTTCACAGCTTCCCCTGTTATAGTAACAGCCTTCACGTTTCATTTCAAT
GTTCATCCAATTGGATTCGAGCTCAAAGATCCATTACAAGTGATCCCAGCAACTAAGCTCTCTGTCATCTTGTGCGCTGC
GATATACTTTGCAACTGGACTCTTCGGGTACCTTCTCTTTGGAGATGCAACAATGTCAGATATTCTAGTGAACTTTGACC
AGAGCTCTGGTTCTTCCATTGGTTCTCTTCTCAACGACATTGTCAGACTCAGCTACGCGCTTCACCTCATGCTGGTCTTT
CCTCTCATGAACTTCTCATTGAGAGCAAATCTCGATGAACTCTTGTTCCCCAAGAAGCCGTCCTTGGAAAAAGACACAAA
AAGATTCATCGGACTCACTCTGGCTCTGCTGATTTGCTGTTTCTTGTCTGCAATCACTGTACCAGACATTTGGTACTTCT
TTCAGTTCTTGGGATCAACCACCACAGTCTCCATAGCATTCATATTTCCAGCCGCTATTGTTCTAAGGAATATCCATGGT
GTATCAACCTCAAGAGAGAAGATCGTAGCTGCAATTATGCTTGTTCTTGCTGTTGCCACTAGCATTATTGCTATCTCGAC
AAATTTATACAGCCTCGCAGCAAACTAA