Details for Lyrate rockcress Locus 16052992

Position : sca3 ( 5`- 5292204 .. 5291150 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478688 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052992

Protein [Map View]
MAVSTVSSFLLPSFVIPSSSPSSNRLKVSLLPSSSTHGGLSSSVLTKPSVSLTKVIAVPETLDPTPEILDEPASEVPSSS
SISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKKRIYCVLKSPHVHKDARFHFEIRTHQ
RMIDILYPTAQTIDSLMQLDLPAGVDVEVKL*

DNA
ATGGCGGTTTCTACTGTATCTTCGTTTCTATTACCCTCCTTCGTCATTCCAAGCTCTTCGCCTTCTTCTAACAGACTCAA
AGTCTCTCTGCTACCTTCATCGTCTACCCATGGCGGCCTTAGTTCCTCCGTCCTTACTAAACCCTCCGTTTCTCTTACGA
AGGTCATCGCGGTTCCGGAAACCCTAGATCCAACTCCAGAAATTCTCGATGAACCCGCCTCTGAGGTTCCGAGCTCTTCC
TCCATCAGTGTAGATGCTGATAAGATGGCGCCAAAGCAAAAGATTAGGATCAAGCTTAGATCATACTGGGTGCCTCTTAT
TGAGGACTCATGCAAGCAGATTCTTGATGCTGCTAGAAATACTAATGCAAAGACGATGGGTCCTGTTCCATTGCCAACCA
AGAAGCGTATCTACTGTGTTCTTAAGTCTCCTCACGTACACAAGGATGCTAGGTTCCATTTTGAAATCCGGACACACCAG
CGTATGATTGATATTCTCTACCCGACTGCTCAAACTATCGATTCTTTGATGCAACTTGATCTTCCTGCTGGTGTTGATGT
GGAAGTGAAGCTCTGA