Details for Lyrate rockcress Locus 16052968

Position : sca3 ( 5`- 7088432 .. 7086501 -3` )
Annotation : [B2G] nodulin 3 family protein
External links : CoGe
PGDD synteny : 16052968

Protein [Map View]
MVDLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECLPYICTLMSSSLWTYYGIVTPGEYLVSTVNGFGALAESI
YVLIFLFFVPKPRFLKTIVVVLALNVCFPVLAIVGTRTAFEDENKRSSSMGFICATLNIAMYGSPLSAIKTVVTTRSVQF
MPFWLSFFLFLNGAIWGVYAFLLHDVFLLVPNGMGFLLGTMQLLIYAYYRNAQPNVEDEEGLIPSQPLLS*

DNA
ATGGTAGACTTGAGTTTCTATGTTGGAGTCATAGGAAATGTGATATCGGTGCTTGTCTTCCTCTCCCCTGTGGAGACGTT
TTGGAGGATAGTGCAACGTAGATCGACGGAGGAGTACGAGTGTTTGCCGTACATTTGCACGTTGATGAGCTCGTCGTTAT
GGACATATTACGGAATAGTGACACCTGGTGAATACTTGGTTTCTACGGTCAATGGCTTTGGTGCTCTTGCTGAATCCATT
TATGTTCTCATTTTCCTCTTCTTTGTCCCCAAACCCAGATTCTTGAAAACAATTGTAGTGGTTCTAGCTTTGAACGTGTG
TTTCCCAGTTTTGGCGATTGTGGGAACAAGAACTGCGTTTGAAGATGAAAACAAGCGTTCGAGTTCAATGGGTTTCATAT
GTGCTACTCTCAACATCGCCATGTATGGTTCTCCTCTTTCAGCTATTAAAACGGTTGTGACGACGAGGAGTGTGCAATTT
ATGCCGTTTTGGTTGTCGTTTTTCCTTTTCCTAAACGGTGCGATTTGGGGTGTCTACGCTTTCCTCCTACATGATGTTTT
TCTACTAGTGCCAAATGGAATGGGGTTCTTGCTTGGGACAATGCAACTCCTAATTTATGCCTATTACAGAAATGCCCAAC
CTAATGTAGAAGATGAAGAAGGCCTCATACCAAGCCAACCTCTTCTCTCTTAA