Details for Lyrate rockcress Locus 16052965

Position : sca3 ( 5`- 5789191 .. 5792740 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052965

Protein [Map View]
MSMQPIPQSKSSSNGFPLKRGERDEVLNKANTSNTAFNGEVGSLERPSLDRLVYLSACYIGHHVEVHLRNGSVYTGIFHA
ADVEKDFGIILKMACLIKDGTLRGHKSRSEFVRKPPSKTFIIPADELVQVIAKDLSVSSTNMSNAVQGEKPAELLTDSSI
SQSYHVDRERQLQPWVPDETIPQGADLENVFDNPWNRKWNQFEVNESLFGVKSTFDEEIYTTRLERGPQTKQLEEQARKI
AREIEAETTRDLHVAEERGLQLNENFDFDEEARYSSVRPVTGFGDSGFDEEDNALLDTCNDLTFGGSSTSDGQKPASSGK
GCEELRGDSQSSRNNTNVDQSFSTSKEQSKYFPAAGNKISESQLDERRRNNNQESHNNRSAEESTSGHGDIKEGAKFGGG
ATSVSKAVTEREREASQVSSKTKSESSFGQSASRSSESRPGPSTSSRPGLSPSSSIGSMTSSEKSTLNPNAKEFKLNPNA
KSFKPSQPAAVRPQSPVSDASFYYPGPSHVPPVQQMPGMPPVNYGVPPYPGNQPPMMYHPQTYYHPNGQPQYPQQQMMPG
QQQQMMPGQQQPRPVYYMQHPPPPYPQDMPYHNKGRE*

DNA
ATGAGTATGCAACCTATTCCTCAGTCGAAATCTTCATCAAATGGATTTCCACTCAAAAGAGGTGAAAGAGACGAAGTATT
AAATAAGGCAAATACATCTAATACAGCATTCAATGGGGAAGTTGGAAGCTTGGAGAGGCCTTCGCTTGATCGGTTAGTGT
ACCTCTCAGCATGTTATATCGGGCATCATGTGGAAGTGCATCTAAGGAATGGATCAGTGTATACTGGTATATTTCATGCT
GCTGATGTAGAGAAGGATTTTGGAATCATTCTAAAGATGGCATGTTTGATTAAAGATGGTACTTTACGAGGGCATAAATC
CCGTTCCGAATTTGTCAGAAAGCCGCCTTCCAAGACATTCATTATTCCTGCAGATGAACTTGTGCAAGTTATAGCTAAGG
ATCTCTCTGTATCCTCGACCAACATGTCAAATGCGGTTCAGGGTGAGAAACCTGCGGAGCTGTTGACAGACTCTTCTATA
TCACAGTCTTATCATGTTGATCGGGAAAGACAGCTGCAACCCTGGGTACCTGATGAGACTATTCCACAGGGTGCAGATTT
GGAGAATGTGTTTGATAACCCTTGGAATAGGAAATGGAATCAGTTTGAGGTGAATGAGTCACTGTTTGGAGTAAAGAGTA
CTTTCGACGAGGAAATCTATACCACAAGACTTGAGAGAGGTCCTCAGACTAAACAGTTGGAAGAGCAAGCCCGGAAGATT
GCGAGAGAGATCGAGGCTGAGACTACCCGAGATCTTCATGTAGCAGAGGAAAGGGGCCTTCAGCTTAATGAGAACTTTGA
TTTTGACGAGGAAGCCAGATACTCCTCTGTCCGTCCAGTTACTGGATTTGGTGATAGTGGGTTTGATGAGGAGGACAACG
CATTGCTGGATACTTGCAACGATCTGACTTTTGGTGGTTCATCTACTTCTGATGGCCAGAAGCCAGCTTCTAGTGGCAAG
GGCTGTGAAGAATTACGGGGTGACAGTCAGTCTTCTCGGAATAATACAAATGTAGATCAAAGCTTCTCGACCTCTAAAGA
ACAATCCAAATATTTTCCTGCCGCAGGCAACAAGATCAGTGAGAGCCAGCTAGATGAGCGAAGAAGAAACAATAACCAAG
AGTCACACAATAACAGATCAGCTGAGGAATCAACTTCCGGTCATGGAGATATCAAAGAAGGTGCAAAATTTGGTGGTGGT
GCAACCTCGGTGTCGAAGGCTGTTACTGAGAGAGAAAGAGAAGCCAGTCAAGTTTCTAGTAAAACAAAATCTGAAAGCTC
TTTCGGGCAGTCGGCTTCTAGAAGTTCAGAAAGTCGCCCAGGTCCTTCAACATCAAGTCGTCCTGGGCTATCACCGAGCT
CGTCAATTGGTTCTATGACCTCATCAGAAAAGTCCACACTTAATCCGAATGCAAAGGAATTCAAACTCAATCCAAACGCG
AAGAGTTTCAAACCATCGCAACCAGCTGCTGTGCGACCTCAATCTCCAGTTTCAGATGCCTCATTCTACTATCCTGGTCC
TAGTCATGTTCCTCCTGTTCAGCAGATGCCTGGAATGCCGCCTGTTAATTACGGAGTCCCGCCATATCCTGGCAACCAAC
CACCGATGATGTATCATCCTCAAACCTATTATCATCCAAATGGACAACCTCAGTATCCGCAGCAGCAAATGATGCCTGGT
CAGCAGCAGCAAATGATGCCTGGCCAGCAGCAGCCTAGGCCAGTTTATTACATGCAGCATCCTCCTCCTCCTTACCCGCA
GGACATGCCATATCATAATAAAGGACGAGAGTAA