Details for Lyrate rockcress Locus 16052959

Position : sca3 ( 5`- 3885264 .. 3887792 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478305 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052959

Protein [Map View]
MASSDFDGILLGMGNPLLDVSAVVDQEFLDKYDIKLNNAILAEDKHLPMYDEMSQKFNVEYIAGGATQNSIKVAQWMLQI
PGATSYMGSIGKDKYGEAMKKDATAAGVNVHYYEDESTPTGTCGVCVLGGERSLIANLSAANCYKVEHLKKPENWALVEK
AKFYYIAGFFLTVSPESIQLVREHAAANNKVFTMNLSAPFICEFFKDVQEKCIPYMDYIFGNETEARTFSRVHGWETDDV
EQIAIKMSQLPKATGTYKRTTVITQGADPVVVAEDGKVKKYPVIALPKEKLVDTNGAGDAFVGGFLSQLVHGKGIEECVR
AGCYASNVVIQRSGCTYPEKPDFN*

DNA
ATGGCTTCCTCTGATTTCGATGGTATCCTTTTGGGAATGGGAAACCCACTCCTCGACGTCTCTGCCGTCGTCGACCAAGA
GTTTCTCGACAAATACGACATCAAATTGAACAATGCGATTCTCGCTGAGGACAAACATTTGCCCATGTACGATGAAATGA
GCCAGAAGTTCAATGTTGAATACATTGCTGGAGGTGCTACCCAGAACTCAATCAAAGTGGCCCAGTGGATGCTTCAAATT
CCTGGGGCTACCAGTTACATGGGATCAATTGGAAAAGACAAATACGGAGAGGCAATGAAAAAGGATGCTACAGCAGCTGG
TGTCAATGTCCACTATTACGAAGATGAGTCAACACCTACCGGAACTTGCGGTGTCTGTGTTCTTGGTGGAGAAAGGTCGC
TCATTGCGAATCTTTCTGCTGCTAATTGCTACAAGGTTGAACACTTGAAGAAGCCTGAGAACTGGGCTCTGGTTGAGAAG
GCTAAGTTCTACTACATTGCTGGATTCTTCCTCACGGTGTCACCAGAATCCATTCAGTTGGTACGTGAACATGCCGCTGC
AAACAACAAGGTGTTCACGATGAACCTTTCTGCTCCATTCATCTGTGAATTCTTCAAAGATGTTCAGGAGAAGTGCATAC
CGTACATGGACTATATTTTTGGCAATGAGACCGAGGCAAGAACCTTCTCCAGGGTTCACGGCTGGGAGACTGATGATGTT
GAGCAAATAGCCATCAAGATGTCCCAGTTGCCCAAAGCCACTGGAACGTACAAGAGGACTACTGTGATTACACAAGGCGC
AGACCCCGTGGTTGTCGCCGAGGATGGAAAAGTGAAGAAGTACCCAGTCATCGCTCTCCCCAAGGAGAAGCTTGTTGACA
CCAACGGTGCAGGTGATGCGTTTGTGGGAGGGTTTCTTTCGCAGCTGGTGCACGGAAAGGGGATTGAAGAGTGCGTGAGG
GCAGGATGCTACGCTTCAAACGTAGTGATCCAGAGGTCTGGATGCACTTACCCTGAGAAACCAGACTTCAACTAA