Details for Lyrate rockcress Locus 16052905

Position : sca3 ( 5`- 10155285 .. 10152897 -3` )
Annotation : [B2G] homocysteine s-methyltransferase 3
External links : CoGe
PGDD synteny : 16052905

Protein [Map View]
MGSFVKEETSSLMTDFLENCGGYAVVDGGFATELQRHGADINDPLWSAKCLITSPHLVTKVHLDYLESGANIIITASYQA
TIQGFVAKGLSVEEAENLLRRSVEITYEAREIFYNRCTKGSWDFAYAGKASRRPILVAASVGSYGAYLADGSEYSGIYGD
SVSKETLKDFHRRRVQILANSGADFIAFETIPNKLEAEAYADLLEEEDINIPAWFSFTSKDGVTVPRGDSVVECAKVADS
CKKVVAIGINCTAPRYIHDLIISLRQVTRKPIVVYPNSGEIYDGLNKKWIRSEGESEEDFVSYVSKWRDAGASLFGGCCR
TTPNTIRAIAKVLSDESPATAKPKFRQ*

DNA
ATGGGATCTTTCGTGAAAGAGGAAACGTCGTCGTTGATGACGGATTTTTTGGAGAACTGTGGCGGTTATGCGGTGGTAGA
CGGAGGGTTTGCGACGGAGCTACAACGCCACGGGGCTGATATCAATGATCCACTTTGGAGTGCTAAGTGCCTCATTACTT
CTCCTCATCTTGTTACAAAGGTGCACTTGGATTACCTTGAATCTGGAGCAAATATCATCATTACAGCATCTTACCAGGCG
ACGATCCAAGGATTCGTAGCAAAAGGTTTATCGGTGGAAGAAGCGGAAAATTTACTTAGGAGGAGCGTTGAAATCACGTA
CGAAGCACGTGAGATATTCTACAACAGATGCACCAAGGGTTCATGGGATTTCGCCTACGCCGGAAAAGCTTCCCGGCGAC
CTATTCTTGTTGCAGCTTCCGTTGGTAGCTATGGAGCTTATCTCGCTGACGGCTCCGAATACAGTGGGATATATGGAGAT
TCTGTGAGTAAGGAGACATTAAAGGACTTCCATAGAAGAAGAGTTCAAATCTTAGCAAACTCTGGAGCCGATTTCATCGC
ATTCGAGACTATTCCAAATAAACTCGAAGCAGAGGCTTATGCGGATCTTCTTGAGGAGGAAGACATCAATATTCCGGCAT
GGTTTTCGTTTACTTCGAAGGACGGAGTCACTGTGCCACGAGGAGATTCGGTTGTAGAATGTGCGAAAGTGGCAGATTCT
TGCAAGAAAGTGGTGGCCATTGGAATCAATTGTACTGCACCAAGATACATACATGATTTAATTATCTCCTTGCGTCAGGT
GACCCGCAAACCGATCGTTGTGTACCCAAATAGTGGGGAAATCTACGACGGTCTGAACAAGAAATGGATTAGGTCAGAGG
GAGAGTCAGAGGAGGATTTTGTGTCGTACGTGAGTAAATGGAGAGATGCAGGAGCATCTCTGTTTGGAGGATGTTGTCGG
ACTACTCCAAACACCATCAGAGCCATTGCTAAAGTTCTCTCCGACGAATCTCCCGCAACAGCAAAACCCAAATTCCGGCA
GTAG